Y416 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Y416 - UPF0218 protein SSO0416

UniProt:	Q980A1	Sequences: MEVRNNNKVNLCFSFDNLRNELSRPYGILFINNKIFLEFISKSIQRGSRIITVGDYVSRVLEENGIVPFLEVIDGKTKRTITQNRAITRNKEYKVTNEAGKIRFEIFEIMENILKDREGGVVFVDGEEDLLVIPVTLSANHGDIVIYGQPNAGAVVIIVNEMIRWRVRDILEKAIVKEC	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	179 (158)
Sequences:	208 (171)
Seq/√Len:	13.6

SULSO - Y416

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
106_I	131_L	7.949	1.00
78_K	151_N	7.056	1.00
52_T	61_L	5.235	1.00
149_Q	155_V	4.082	1.00
56_Y	77_T	2.892	0.96
98_E	103_R	2.748	0.95
25_P	149_Q	2.743	0.95
150_P	153_G	2.205	0.86
70_L	135_V	2.201	0.86
149_Q	152_A	2.172	0.85
132_V	135_V	2.172	0.85
26_Y	100_G	2.100	0.83
23_S	149_Q	2.028	0.80
66_I	102_I	2.026	0.80
23_S	26_Y	2.015	0.80
57_V	136_T	1.996	0.79
141_H	164_R	1.955	0.78
21_E	173_K	1.814	0.72
15_F	19_R	1.812	0.72
22_L	174_A	1.751	0.69
99_A	142_G	1.636	0.64
53_V	113_I	1.626	0.63
30_F	56_Y	1.615	0.63
25_P	155_V	1.608	0.63
92_E	123_F	1.564	0.60
134_P	149_Q	1.549	0.60
72_V	122_V	1.530	0.59
72_V	110_M	1.520	0.58
73_I	93_Y	1.466	0.55
23_S	152_A	1.439	0.54
22_L	62_E	1.406	0.52
27_G	149_Q	1.405	0.52
146_I	154_A	1.398	0.52
136_T	167_V	1.390	0.51
141_H	159_V	1.355	0.49
35_I	164_R	1.335	0.48
133_I	157_I	1.321	0.47
163_I	167_V	1.308	0.47
152_A	155_V	1.301	0.46
57_V	77_T	1.292	0.46
113_I	138_S	1.285	0.46
106_I	109_I	1.249	0.44
102_I	111_E	1.236	0.43
120_G	174_A	1.230	0.43
107_F	138_S	1.229	0.43
52_T	58_S	1.224	0.42
171_L	174_A	1.200	0.41
15_F	155_V	1.194	0.41
16_D	133_I	1.179	0.40
77_T	95_V	1.165	0.39
105_E	174_A	1.139	0.38
122_V	139_A	1.125	0.37
101_K	171_L	1.119	0.37
18_L	98_E	1.116	0.37
19_R	99_A	1.112	0.37
26_Y	149_Q	1.106	0.36
34_K	38_E	1.091	0.36
53_V	73_I	1.089	0.35
84_N	102_I	1.081	0.35
62_E	141_H	1.077	0.35
16_D	19_R	1.072	0.35
23_S	155_V	1.060	0.34
110_M	122_V	1.040	0.33
79_R	147_Y	1.038	0.33
50_I	105_E	1.037	0.33
58_S	95_V	1.031	0.33
51_I	135_V	1.029	0.33
96_T	125_D	1.019	0.32
29_L	103_R	1.014	0.32
75_G	80_T	1.005	0.31
90_N	121_V	1.003	0.31
99_A	167_V	0.998	0.31
22_L	170_I	0.989	0.31
94_K	99_A	0.981	0.30
16_D	174_A	0.979	0.30
133_I	136_T	0.979	0.30
76_K	96_T	0.978	0.30
140_N	152_A	0.978	0.30
49_R	69_F	0.968	0.30
122_V	151_N	0.966	0.30
50_I	61_L	0.964	0.30
15_F	152_A	0.948	0.29
19_R	58_S	0.945	0.29
53_V	145_V	0.937	0.28
23_S	162_M	0.922	0.28
37_L	119_G	0.896	0.27
87_I	107_F	0.896	0.27
32_N	164_R	0.891	0.26
14_S	111_E	0.889	0.26
20_N	144_I	0.871	0.26
13_F	171_L	0.871	0.26
95_V	118_E	0.870	0.26
160_N	163_I	0.868	0.26
80_T	115_K	0.861	0.25
49_R	52_T	0.860	0.25
70_L	89_R	0.860	0.25
157_I	163_I	0.860	0.25
57_V	171_L	0.853	0.25
38_E	164_R	0.852	0.25
80_T	103_R	0.850	0.25
75_G	146_I	0.846	0.25
102_I	175_I	0.844	0.25
169_D	173_K	0.834	0.24
58_S	71_E	0.819	0.24
50_I	66_I	0.817	0.23
112_N	120_G	0.810	0.23
67_V	71_E	0.809	0.23
119_G	164_R	0.809	0.23
139_A	160_N	0.803	0.23
140_N	160_N	0.799	0.23
57_V	146_I	0.797	0.23
111_E	138_S	0.797	0.23
19_R	57_V	0.794	0.23
111_E	133_I	0.793	0.23
140_N	143_D	0.791	0.23
31_I	105_E	0.780	0.22
134_P	152_A	0.776	0.22
98_E	140_N	0.766	0.22
21_E	29_L	0.760	0.21
161_E	173_K	0.756	0.21
99_A	111_E	0.753	0.21
80_T	137_L	0.750	0.21
72_V	166_R	0.745	0.21
27_G	130_L	0.733	0.20
76_K	81_I	0.731	0.20
52_T	72_V	0.729	0.20
72_V	94_K	0.725	0.20
75_G	113_I	0.722	0.20
93_Y	125_D	0.721	0.20
22_L	133_I	0.717	0.20
21_E	146_I	0.716	0.20
73_I	167_V	0.716	0.20
37_L	75_G	0.715	0.20
126_G	129_D	0.709	0.20
55_D	129_D	0.709	0.20
129_D	148_G	0.709	0.20
127_E	148_G	0.709	0.20
74_D	148_G	0.709	0.20
74_D	129_D	0.709	0.20
126_G	148_G	0.709	0.20
74_D	127_E	0.709	0.20
55_D	126_G	0.709	0.20
55_D	148_G	0.709	0.20
54_G	129_D	0.709	0.20
54_G	148_G	0.709	0.20
55_D	74_D	0.709	0.20
54_G	126_G	0.709	0.20
74_D	126_G	0.709	0.20
54_G	127_E	0.709	0.20
54_G	74_D	0.709	0.20
55_D	127_E	0.709	0.20
105_E	108_E	0.706	0.19
27_G	153_G	0.700	0.19
118_E	164_R	0.685	0.19
38_E	73_I	0.682	0.19
63_E	94_K	0.674	0.18
81_I	143_D	0.672	0.18
103_R	139_A	0.672	0.18
66_I	69_F	0.671	0.18
100_G	162_M	0.669	0.18
103_R	131_L	0.669	0.18
103_R	106_I	0.657	0.18
30_F	64_N	0.655	0.18
36_F	57_V	0.651	0.18
144_I	156_V	0.651	0.18
63_E	133_I	0.641	0.17
68_P	140_N	0.634	0.17
158_I	175_I	0.626	0.17
13_F	142_G	0.623	0.17
73_I	121_V	0.618	0.17
159_V	170_I	0.615	0.17
104_F	144_I	0.613	0.17
132_V	145_V	0.612	0.17
22_L	171_L	0.611	0.17
50_I	115_K	0.610	0.16
29_L	110_M	0.609	0.16
132_V	136_T	0.603	0.16
80_T	93_Y	0.597	0.16
29_L	156_V	0.596	0.16
103_R	152_A	0.595	0.16
67_V	70_L	0.594	0.16
29_L	144_I	0.593	0.16
26_Y	131_L	0.592	0.16
28_I	65_G	0.591	0.16
165_W	169_D	0.590	0.16
141_H	160_N	0.589	0.16
162_M	174_A	0.586	0.16
68_P	95_V	0.583	0.16
40_I	73_I	0.580	0.16
104_F	157_I	0.579	0.16
99_A	104_F	0.577	0.16
111_E	115_K	0.576	0.15
81_I	122_V	0.572	0.15
108_E	115_K	0.565	0.15
63_E	138_S	0.565	0.15
130_L	153_G	0.563	0.15
95_V	124_V	0.562	0.15
119_G	160_N	0.561	0.15
100_G	151_N	0.559	0.15
63_E	114_L	0.557	0.15
77_T	107_F	0.553	0.15
107_F	134_P	0.552	0.15
34_K	105_E	0.550	0.15
93_Y	122_V	0.548	0.15
28_I	70_L	0.547	0.15
46_R	130_L	0.546	0.15
14_S	167_V	0.544	0.15
145_V	168_R	0.542	0.15
137_L	161_E	0.541	0.15
92_E	157_I	0.537	0.14
133_I	137_L	0.537	0.14
17_N	70_L	0.536	0.14
70_L	93_Y	0.536	0.14
40_I	66_I	0.535	0.14
113_I	119_G	0.530	0.14
50_I	139_A	0.529	0.14
15_F	153_G	0.528	0.14
136_T	156_V	0.527	0.14
16_D	20_N	0.526	0.14
149_Q	153_G	0.524	0.14
28_I	50_I	0.524	0.14
38_E	64_N	0.519	0.14
53_V	71_E	0.516	0.14
81_I	174_A	0.511	0.14
79_R	129_D	0.509	0.14
79_R	148_G	0.509	0.14
79_R	126_G	0.509	0.14
79_R	127_E	0.509	0.14
54_G	79_R	0.509	0.14
74_D	79_R	0.509	0.14
55_D	79_R	0.509	0.14
58_S	108_E	0.508	0.14
93_Y	109_I	0.507	0.14
21_E	53_V	0.505	0.14
17_N	24_R	0.505	0.14
63_E	96_T	0.501	0.14
72_V	114_L	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4wa8A	1	0.8156	31.8	0.948	Contact Map
2izoA	1	0.7821	26	0.95	Contact Map
1rxwA	1	0.8939	20.4	0.953	Contact Map
1pe9A	1	0.5363	18.4	0.954	Contact Map
3oryA	3	0.8939	17.6	0.954	Contact Map
1jr2A	1	0.4972	16.9	0.954	Contact Map
4ffjA	2	0.3966	13.1	0.957	Contact Map
3mw8A	1	0.7877	12.9	0.957	Contact Map
2yvqA	2	0.2626	11.3	0.958	Contact Map
3re1A	1	0.8156	10	0.959	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.