RS24 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RS24 - 30S ribosomal protein S24e

UniProt:	Q97ZY6	Sequences: MESQAKVKISDKAEGIIERDMQNSVIGRREISLKVYHMGSGTPSRKDIIKAIIQALGSQENLVVVRKISTSYGAGISNVKLHIYKSREILEKVEPKYLLDRDAGTKQKKGGSKGGQGAKG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	120 (110)
Sequences:	346 (197)
Seq/√Len:	18.8

SULSO - RS24

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
31_I	81_L	5.993	1.00
42_T	77_S	4.395	1.00
64_V	90_L	4.248	1.00
113_K	117_G	3.251	0.99
42_T	48_I	2.865	0.99
33_L	81_L	2.285	0.94
65_V	81_L	2.215	0.94
40_S	47_D	2.095	0.91
113_K	116_Q	2.023	0.90
15_G	33_L	1.974	0.89
27_G	93_V	1.950	0.88
54_Q	109_K	1.919	0.87
46_K	60_E	1.738	0.81
59_Q	62_L	1.703	0.80
107_Q	111_G	1.693	0.80
90_L	102_D	1.570	0.74
116_Q	119_K	1.505	0.71
24_S	118_A	1.505	0.71
100_D	105_T	1.452	0.68
36_Y	40_S	1.444	0.67
52_I	118_A	1.444	0.67
52_I	56_L	1.385	0.64
21_M	97_Y	1.363	0.63
84_Y	93_V	1.320	0.60
41_G	63_V	1.312	0.60
69_S	86_S	1.270	0.57
35_V	48_I	1.215	0.54
115_G	118_A	1.185	0.52
25_V	56_L	1.183	0.52
97_Y	101_R	1.180	0.52
27_G	89_I	1.173	0.51
93_V	105_T	1.154	0.50
37_H	73_G	1.152	0.50
18_E	34_K	1.128	0.48
23_N	28_R	1.126	0.48
87_R	90_L	1.119	0.48
112_S	116_Q	1.114	0.48
48_I	87_R	1.112	0.47
20_D	66_R	1.106	0.47
70_T	94_E	1.104	0.47
40_S	89_I	1.103	0.47
15_G	50_K	1.101	0.47
58_S	65_V	1.093	0.46
35_V	68_I	1.081	0.45
102_D	106_K	1.080	0.45
94_E	98_L	1.080	0.45
106_K	109_K	1.071	0.45
111_G	114_G	1.066	0.45
34_K	76_I	1.059	0.44
49_I	90_L	1.056	0.44
65_V	68_I	1.032	0.42
42_T	100_D	1.018	0.42
57_G	67_K	1.018	0.42
27_G	77_S	1.012	0.41
59_Q	65_V	1.006	0.41
30_E	53_I	0.983	0.39
113_K	118_A	0.980	0.39
13_A	65_V	0.980	0.39
49_I	102_D	0.973	0.39
21_M	90_L	0.962	0.38
62_L	65_V	0.960	0.38
47_D	106_K	0.948	0.37
24_S	113_K	0.944	0.37
84_Y	116_Q	0.938	0.37
90_L	99_L	0.919	0.36
54_Q	60_E	0.918	0.36
88_E	92_K	0.918	0.36
11_D	58_S	0.909	0.35
66_R	98_L	0.881	0.34
27_G	33_L	0.880	0.33
48_I	77_S	0.880	0.33
11_D	33_L	0.868	0.33
68_I	77_S	0.862	0.32
32_S	51_A	0.857	0.32
72_Y	84_Y	0.856	0.32
12_K	89_I	0.851	0.32
24_S	65_V	0.838	0.31
64_V	76_I	0.836	0.31
44_S	47_D	0.826	0.30
44_S	110_G	0.820	0.30
74_A	79_V	0.817	0.30
50_K	75_G	0.815	0.30
64_V	102_D	0.810	0.30
51_A	55_A	0.806	0.29
20_D	72_Y	0.805	0.29
13_A	33_L	0.803	0.29
34_K	78_N	0.799	0.29
19_R	92_K	0.788	0.29
21_M	48_I	0.785	0.28
65_V	82_H	0.784	0.28
25_V	72_Y	0.772	0.28
13_A	100_D	0.766	0.27
35_V	43_P	0.758	0.27
96_K	99_L	0.756	0.27
36_Y	55_A	0.752	0.27
51_A	54_Q	0.745	0.26
43_P	68_I	0.742	0.26
49_I	76_I	0.733	0.26
48_I	88_E	0.729	0.26
33_L	93_V	0.717	0.25
67_K	74_A	0.715	0.25
62_L	90_L	0.708	0.25
15_G	76_I	0.707	0.25
16_I	82_H	0.706	0.25
60_E	117_G	0.701	0.24
21_M	88_E	0.699	0.24
65_V	71_S	0.697	0.24
29_R	58_S	0.690	0.24
64_V	91_E	0.688	0.24
44_S	48_I	0.680	0.23
45_R	68_I	0.678	0.23
61_N	65_V	0.675	0.23
86_S	89_I	0.670	0.23
100_D	107_Q	0.669	0.23
11_D	15_G	0.665	0.23
48_I	105_T	0.664	0.23
40_S	44_S	0.663	0.23
61_N	88_E	0.662	0.23
53_I	59_Q	0.655	0.22
13_A	108_K	0.654	0.22
39_G	59_Q	0.644	0.22
13_A	118_A	0.641	0.22
22_Q	65_V	0.640	0.22
65_V	87_R	0.637	0.21
18_E	36_Y	0.634	0.21
71_S	78_N	0.632	0.21
27_G	109_K	0.630	0.21
43_P	75_G	0.629	0.21
21_M	86_S	0.622	0.21
93_V	100_D	0.619	0.21
67_K	78_N	0.611	0.20
37_H	75_G	0.608	0.20
16_I	84_Y	0.600	0.20
46_K	49_I	0.597	0.20
38_M	80_K	0.593	0.20
113_K	119_K	0.589	0.19
12_K	62_L	0.583	0.19
54_Q	63_V	0.578	0.19
58_S	61_N	0.574	0.19
62_L	97_Y	0.570	0.19
33_L	78_N	0.570	0.19
16_I	91_E	0.561	0.18
87_R	91_E	0.557	0.18
14_E	22_Q	0.554	0.18
95_P	104_G	0.550	0.18
103_A	106_K	0.539	0.18
28_R	83_I	0.537	0.18
27_G	105_T	0.537	0.18
40_S	53_I	0.537	0.18
17_I	56_L	0.533	0.17
24_S	27_G	0.531	0.17
45_R	92_K	0.530	0.17
41_G	60_E	0.527	0.17
80_K	91_E	0.525	0.17
96_K	113_K	0.525	0.17
68_I	79_V	0.525	0.17
13_A	39_G	0.520	0.17
50_K	91_E	0.516	0.17
89_I	107_Q	0.510	0.17
21_M	69_S	0.510	0.17
13_A	24_S	0.507	0.16
30_E	72_Y	0.506	0.16
70_T	75_G	0.505	0.16
82_H	95_P	0.503	0.16
18_E	26_I	0.500	0.16

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4w23Y	1	0.9167	100	0.154	Contact Map
3j60Y	1	0.975	100	0.171	Contact Map
3j7a1	1	0.9167	100	0.177	Contact Map
4ujpZ	1	0.925	100	0.184	Contact Map
4bpeP	1	0.9083	100	0.19	Contact Map
3zeyT	1	0.9167	100	0.198	Contact Map
2g1dA	1	0.8167	100	0.288	Contact Map
1ywxA	1	0.85	100	0.299	Contact Map
2v94A	1	0.8167	100	0.303	Contact Map
1xn9A	1	0.8417	100	0.303	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.