ENDA - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ENDA - tRNA-splicing endonuclease

UniProt:	Q97ZY3	Sequences: MVKALLVGSKVLVPSIDESRYLYSNGFYGKPIGISKPKGPKDIVRPLELSLIESVYLTKKGLINVVDKNGDLLEYKKLYEYSAMKINKFEILYKVYEDLREKGFIVRSGVKYGADFAVYTLGPGLEHAPYVVIAVDIDEEITPHELLSFGRVSHSTKKRLVLALVDRKSEGIRYIMFKWVKM	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	182 (162)
Sequences:	837 (618)
Seq/√Len:	48.6

HALSA - ENDA
SULSO - ENDA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
114_A	131_V	3.939	1.00
59_K	97_E	3.779	1.00
74_E	77_K	3.371	1.00
26_G	100_R	3.251	1.00
127_H	151_R	3.046	1.00
11_V	54_S	2.849	1.00
131_V	153_S	2.779	1.00
20_R	24_S	2.749	1.00
15_S	18_E	2.712	1.00
132_V	163_A	2.614	1.00
98_D	102_K	2.318	1.00
95_V	134_A	2.301	1.00
95_V	163_A	2.191	1.00
119_Y	127_H	2.095	1.00
60_K	101_E	2.029	1.00
13_V	22_L	2.000	0.99
27_F	96_Y	1.983	0.99
78_L	82_S	1.901	0.99
28_Y	96_Y	1.787	0.99
49_L	53_E	1.756	0.99
56_Y	117_A	1.754	0.99
102_K	145_E	1.737	0.99
119_Y	151_R	1.652	0.98
113_G	127_H	1.643	0.98
118_V	132_V	1.571	0.97
76_K	80_E	1.569	0.97
77_K	80_E	1.541	0.97
80_E	84_M	1.539	0.97
127_H	156_T	1.515	0.96
93_Y	97_E	1.502	0.96
99_L	118_V	1.494	0.96
117_A	128_A	1.474	0.96
50_S	108_S	1.471	0.96
55_V	89_F	1.469	0.96
29_G	53_E	1.464	0.96
54_S	63_I	1.443	0.95
58_T	63_I	1.399	0.94
40_P	43_I	1.399	0.94
31_P	34_I	1.395	0.94
122_G	125_L	1.390	0.94
154_H	157_K	1.389	0.94
113_G	119_Y	1.368	0.94
96_Y	100_R	1.367	0.94
79_Y	82_S	1.352	0.93
85_K	88_K	1.314	0.92
55_V	93_Y	1.303	0.92
107_R	111_K	1.300	0.92
112_Y	127_H	1.290	0.92
97_E	101_E	1.281	0.91
109_G	112_Y	1.261	0.91
70_G	73_L	1.250	0.90
57_L	96_Y	1.243	0.90
127_H	158_K	1.227	0.89
149_F	160_L	1.219	0.89
113_G	151_R	1.209	0.89
39_G	44_V	1.192	0.88
75_Y	78_L	1.191	0.88
22_L	109_G	1.187	0.88
77_K	84_M	1.165	0.87
56_Y	100_R	1.160	0.87
116_F	134_A	1.159	0.87
55_V	90_E	1.156	0.86
64_N	67_D	1.140	0.86
39_G	42_D	1.135	0.85
65_V	81_Y	1.109	0.84
152_V	156_T	1.106	0.84
27_F	122_G	1.104	0.84
23_Y	122_G	1.092	0.83
79_Y	84_M	1.089	0.83
38_K	42_D	1.083	0.83
51_L	89_F	1.078	0.82
19_S	45_R	1.071	0.82
104_F	118_V	1.070	0.82
95_V	116_F	1.067	0.82
30_K	111_K	1.062	0.81
110_V	147_L	1.058	0.81
48_E	156_T	1.029	0.79
147_L	150_G	1.024	0.79
151_R	156_T	0.999	0.77
30_K	48_E	0.999	0.77
150_G	160_L	0.995	0.77
115_D	133_I	0.994	0.77
26_G	128_A	0.986	0.76
111_K	127_H	0.985	0.76
33_G	99_L	0.982	0.76
37_P	44_V	0.974	0.75
95_V	165_V	0.974	0.75
88_K	115_D	0.968	0.75
100_R	105_I	0.966	0.75
125_L	152_V	0.965	0.75
107_R	117_A	0.960	0.74
128_A	158_K	0.956	0.74
98_D	168_K	0.944	0.73
64_N	72_L	0.943	0.73
106_V	159_R	0.927	0.72
52_I	161_V	0.922	0.71
70_G	74_E	0.922	0.71
81_Y	84_M	0.920	0.71
122_G	126_E	0.910	0.70
100_R	117_A	0.888	0.68
153_S	163_A	0.885	0.68
23_Y	31_P	0.878	0.67
38_K	44_V	0.876	0.67
67_D	73_L	0.874	0.67
70_G	80_E	0.864	0.66
131_V	134_A	0.863	0.66
80_E	83_A	0.861	0.66
71_D	77_K	0.857	0.66
17_D	84_M	0.852	0.65
31_P	101_E	0.852	0.65
83_A	90_E	0.851	0.65
37_P	150_G	0.849	0.65
109_G	151_R	0.846	0.65
33_G	46_P	0.840	0.64
126_E	129_P	0.836	0.64
29_G	47_L	0.829	0.63
33_G	45_R	0.827	0.63
81_Y	85_K	0.822	0.62
151_R	158_K	0.820	0.62
119_Y	158_K	0.814	0.62
125_L	129_P	0.812	0.61
53_E	57_L	0.810	0.61
106_V	153_S	0.803	0.61
122_G	152_V	0.801	0.60
72_L	77_K	0.798	0.60
93_Y	100_R	0.795	0.60
112_Y	151_R	0.795	0.60
94_K	165_V	0.793	0.60
148_S	152_V	0.792	0.59
91_I	128_A	0.786	0.59
22_L	65_V	0.784	0.59
96_Y	142_T	0.780	0.58
34_I	45_R	0.779	0.58
133_I	148_S	0.779	0.58
22_L	140_E	0.775	0.58
14_P	152_V	0.774	0.58
138_D	157_K	0.768	0.57
37_P	42_D	0.750	0.55
23_Y	27_F	0.748	0.55
26_G	105_I	0.737	0.54
109_G	127_H	0.734	0.54
26_G	47_L	0.730	0.53
56_Y	101_E	0.729	0.53
35_S	45_R	0.727	0.53
56_Y	130_Y	0.726	0.53
127_H	152_V	0.723	0.53
58_T	61_G	0.719	0.52
46_P	124_G	0.715	0.52
112_Y	119_Y	0.705	0.51
91_I	94_K	0.702	0.50
111_K	129_P	0.700	0.50
149_F	156_T	0.699	0.50
91_I	134_A	0.697	0.50
86_I	89_F	0.688	0.49
89_F	93_Y	0.681	0.48
65_V	89_F	0.680	0.48
118_V	130_Y	0.679	0.48
71_D	84_M	0.678	0.48
31_P	45_R	0.676	0.48
36_K	39_G	0.674	0.48
93_Y	114_A	0.673	0.48
119_Y	156_T	0.670	0.47
114_A	155_S	0.669	0.47
109_G	128_A	0.668	0.47
59_K	93_Y	0.663	0.47
122_G	129_P	0.663	0.47
39_G	43_I	0.662	0.46
74_E	79_Y	0.660	0.46
48_E	143_P	0.650	0.45
29_G	100_R	0.648	0.45
146_L	152_V	0.646	0.45
11_V	63_I	0.645	0.45
92_L	95_V	0.643	0.45
11_V	110_V	0.642	0.44
73_L	81_Y	0.633	0.44
115_D	134_A	0.631	0.43
96_Y	105_I	0.629	0.43
9_S	108_S	0.629	0.43
41_K	44_V	0.626	0.43
91_I	157_K	0.623	0.43
25_N	100_R	0.623	0.43
47_L	53_E	0.621	0.42
77_K	81_Y	0.620	0.42
55_V	134_A	0.614	0.42
150_G	157_K	0.612	0.41
57_L	63_I	0.611	0.41
56_Y	62_L	0.610	0.41
13_V	49_L	0.608	0.41
87_N	169_S	0.607	0.41
79_Y	166_D	0.604	0.41
62_L	165_V	0.603	0.41
112_Y	120_T	0.599	0.40
71_D	76_K	0.599	0.40
115_D	146_L	0.594	0.40
82_S	146_L	0.593	0.40
13_V	19_S	0.592	0.40
124_G	128_A	0.588	0.39
129_P	154_H	0.588	0.39
133_I	161_V	0.587	0.39
23_Y	121_L	0.586	0.39
28_Y	97_E	0.579	0.38
130_Y	149_F	0.577	0.38
102_K	115_D	0.576	0.38
17_D	20_R	0.574	0.38
8_G	65_V	0.570	0.37
24_S	77_K	0.569	0.37
10_K	48_E	0.568	0.37
89_F	100_R	0.567	0.37
61_G	99_L	0.567	0.37
116_F	130_Y	0.567	0.37
101_E	104_F	0.566	0.37
125_L	164_L	0.564	0.37
50_S	106_V	0.562	0.37
60_K	97_E	0.561	0.37
120_T	129_P	0.560	0.36
98_D	101_E	0.555	0.36
12_L	32_I	0.554	0.36
100_R	165_V	0.554	0.36
16_I	52_I	0.554	0.36
80_E	157_K	0.553	0.36
16_I	84_M	0.552	0.36
32_I	155_S	0.549	0.35
48_E	123_P	0.544	0.35
7_V	19_S	0.544	0.35
132_V	135_V	0.543	0.35
26_G	93_Y	0.543	0.35
53_E	56_Y	0.542	0.35
106_V	118_V	0.539	0.35
47_L	70_G	0.538	0.34
51_L	82_S	0.534	0.34
146_L	150_G	0.529	0.34
98_D	104_F	0.528	0.34
23_Y	129_P	0.520	0.33
59_K	79_Y	0.520	0.33
11_V	116_F	0.515	0.32
88_K	136_D	0.514	0.32
10_K	153_S	0.511	0.32
161_V	164_L	0.510	0.32
8_G	116_F	0.508	0.32
71_D	75_Y	0.508	0.32
14_P	111_K	0.507	0.32
78_L	81_Y	0.504	0.31
49_L	115_D	0.500	0.31

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2zyzB	2	0.9945	100	0.141	Contact Map
2cv8A	3	0.989	100	0.153	Contact Map
3ajvB	2	0.978	100	0.156	Contact Map
1a79A	4	0.9231	100	0.216	Contact Map
1r0vA	2	0.8516	100	0.246	Contact Map
4fz2A	2	0.9341	100	0.275	Contact Map
3ieyA	2	0.7637	100	0.29	Contact Map
3ajvA	1	0.8626	100	0.316	Contact Map
3ieyB	1	0.8187	100	0.32	Contact Map
2ohcA	2	0.7308	100	0.376	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0075 seconds.