Q97ZX3 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97ZX3 - Uncharacterized protein

UniProt:	Q97ZX3	Sequences: MSLLIRLAKFALVGGLGTIVNEVTYVLASKTIPIGVSLAIAIEISLIFNFVLNDIWTFKDKRNNSYLNRLLKFHGSSYLGNIVQYIVALVLLVYLLHISSISDAVFILFFSKLAASTFTLVLTNFIGIVSGFVVRFITSLKYVWA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	145 (118)
Sequences:	282 (221)
Seq/√Len:	20.3

BACSU - YNGA
HALSA - Q9HNK2 Q9HQ53
SULSO - Q97ZX3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
22_E	124_N	3.858	1.00
139_S	143_V	3.584	1.00
87_V	131_G	2.853	0.99
43_E	74_H	2.746	0.99
24_T	44_I	2.683	0.98
50_F	69_R	2.641	0.98
127_G	131_G	2.536	0.98
91_L	126_I	2.526	0.98
16_L	48_F	2.341	0.96
54_D	69_R	2.325	0.96
21_N	38_L	2.184	0.94
35_G	89_L	2.125	0.93
38_L	124_N	2.101	0.93
83_V	134_V	2.061	0.92
73_F	139_S	2.039	0.92
25_Y	120_L	2.031	0.92
7_L	135_R	1.950	0.90
29_S	120_L	1.847	0.87
25_Y	41_A	1.783	0.85
21_N	41_A	1.776	0.85
41_A	124_N	1.770	0.85
49_N	73_F	1.659	0.81
25_Y	124_N	1.630	0.80
75_G	79_L	1.530	0.75
50_F	76_S	1.461	0.72
132_F	137_I	1.404	0.69
9_K	123_T	1.388	0.68
87_V	92_L	1.374	0.67
6_R	54_D	1.365	0.66
38_L	88_A	1.352	0.66
25_Y	88_A	1.298	0.62
15_G	19_I	1.264	0.60
70_L	126_I	1.253	0.59
15_G	48_F	1.244	0.59
6_R	60_D	1.234	0.58
18_T	132_F	1.230	0.58
49_N	139_S	1.224	0.58
12_L	24_T	1.220	0.57
24_T	79_L	1.209	0.57
35_G	39_A	1.194	0.56
6_R	43_E	1.194	0.56
47_I	70_L	1.192	0.56
94_Y	130_S	1.167	0.54
88_A	120_L	1.138	0.52
28_A	32_I	1.116	0.51
53_N	57_T	1.110	0.50
28_A	40_I	1.097	0.49
122_L	133_V	1.083	0.48
71_L	86_I	1.072	0.48
23_V	27_L	1.068	0.47
83_V	131_G	1.053	0.47
19_I	41_A	1.045	0.46
7_L	93_V	1.039	0.46
67_L	122_L	1.031	0.45
17_G	49_N	1.030	0.45
81_N	84_Q	1.023	0.45
73_F	136_F	1.023	0.45
20_V	41_A	1.018	0.44
23_V	44_I	0.997	0.43
78_Y	137_I	0.990	0.42
6_R	69_R	0.986	0.42
27_L	32_I	0.978	0.42
16_L	139_S	0.954	0.40
47_I	130_S	0.952	0.40
77_S	139_S	0.951	0.40
80_G	83_V	0.946	0.40
23_V	70_L	0.939	0.39
87_V	127_G	0.938	0.39
56_W	126_I	0.938	0.39
45_S	127_G	0.937	0.39
5_I	9_K	0.937	0.39
40_I	68_N	0.934	0.39
73_F	77_S	0.926	0.38
41_A	70_L	0.923	0.38
68_N	136_F	0.921	0.38
76_S	143_V	0.918	0.38
47_I	74_H	0.908	0.37
47_I	50_F	0.880	0.36
25_Y	44_I	0.878	0.35
44_I	87_V	0.877	0.35
53_N	56_W	0.867	0.35
8_A	67_L	0.855	0.34
50_F	143_V	0.855	0.34
20_V	49_N	0.850	0.34
93_V	135_R	0.850	0.34
5_I	23_V	0.848	0.34
42_I	46_L	0.844	0.33
12_L	65_S	0.824	0.32
53_N	58_F	0.810	0.32
28_A	37_S	0.802	0.31
24_T	28_A	0.772	0.29
20_V	44_I	0.769	0.29
76_S	139_S	0.764	0.29
46_L	77_S	0.750	0.28
32_I	37_S	0.746	0.28
34_I	40_I	0.743	0.28
9_K	56_W	0.743	0.28
49_N	77_S	0.739	0.28
43_E	54_D	0.725	0.27
46_L	58_F	0.724	0.27
21_N	45_S	0.722	0.27
21_N	124_N	0.721	0.27
52_L	73_F	0.711	0.26
51_V	66_Y	0.710	0.26
8_A	62_R	0.694	0.25
42_I	45_S	0.690	0.25
40_I	88_A	0.689	0.25
29_S	124_N	0.679	0.25
25_Y	78_Y	0.672	0.24
52_L	139_S	0.668	0.24
71_L	75_G	0.664	0.24
88_A	124_N	0.663	0.24
11_A	93_V	0.661	0.24
75_G	86_I	0.660	0.24
75_G	78_Y	0.655	0.23
31_T	55_I	0.654	0.23
84_Q	88_A	0.650	0.23
35_G	93_V	0.641	0.23
38_L	41_A	0.641	0.23
12_L	59_K	0.640	0.23
7_L	67_L	0.639	0.23
30_K	136_F	0.638	0.23
48_F	52_L	0.635	0.23
77_S	142_Y	0.635	0.23
73_F	140_L	0.632	0.22
86_I	130_S	0.627	0.22
7_L	132_F	0.623	0.22
136_F	140_L	0.621	0.22
43_E	69_R	0.618	0.22
24_T	27_L	0.615	0.22
80_G	134_V	0.612	0.22
69_R	74_H	0.605	0.21
21_N	28_A	0.597	0.21
8_A	61_K	0.590	0.21
10_F	45_S	0.587	0.20
54_D	74_H	0.586	0.20
37_S	124_N	0.584	0.20
127_G	132_F	0.584	0.20
7_L	137_I	0.583	0.20
91_L	130_S	0.580	0.20
68_N	130_S	0.579	0.20
54_D	136_F	0.577	0.20
130_S	133_V	0.577	0.20
55_I	59_K	0.575	0.20
76_S	84_Q	0.571	0.20
81_N	123_T	0.570	0.20
54_D	140_L	0.569	0.20
77_S	140_L	0.567	0.20
19_I	68_N	0.565	0.20
44_I	124_N	0.554	0.19
9_K	63_N	0.552	0.19
20_V	73_F	0.552	0.19
79_L	83_V	0.552	0.19
43_E	46_L	0.550	0.19
16_L	49_N	0.549	0.19
12_L	97_H	0.548	0.19
43_E	47_I	0.546	0.19
37_S	46_L	0.545	0.19
89_L	92_L	0.545	0.19
15_G	39_A	0.541	0.19
27_L	30_K	0.541	0.19
51_V	55_I	0.540	0.19
29_S	33_P	0.534	0.18
77_S	143_V	0.533	0.18
16_L	19_I	0.532	0.18
21_N	76_S	0.531	0.18
23_V	55_I	0.527	0.18
21_N	48_F	0.527	0.18
120_L	124_N	0.521	0.18
118_F	126_I	0.519	0.18
22_E	134_V	0.517	0.18
6_R	72_K	0.516	0.18
84_Q	123_T	0.514	0.18
39_A	51_V	0.506	0.17
6_R	140_L	0.501	0.17
53_N	121_V	0.500	0.17
27_L	51_V	0.500	0.17

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3rlfF	1	0.3724	4	0.952	Contact Map
1sa3A	1	0.4759	2.1	0.958	Contact Map
4wgvA	2	0.8345	2	0.959	Contact Map
2khvA	1	0.2345	1.7	0.961	Contact Map
2kkpA	1	0.269	1.6	0.961	Contact Map
4lz6A	1	0.4552	1.6	0.961	Contact Map
3mktA	1	0.9103	1.5	0.962	Contact Map
3mp7B	1	0.2069	1.4	0.963	Contact Map
2ww9B	1	0.2207	1.2	0.964	Contact Map
3w4tA	1	0.4207	1.2	0.964	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.