Q97ZW2 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97ZW2 - Uncharacterized protein

UniProt:	Q97ZW2	Sequences: MEHDSVGSIDNHCIRTNISIMVNKVIIKKIIGISTFFLMFLVTLGFMVGLLATFIDSTSLYYLEQLNYLVIKGYYSELFTSIFITNSFVDFIFNFISLYVIYLIFGSRAGKHEYGIFILAGILGNLLTVIFYSPFTLSSGASGGIFGLLSYYTFYDFLKKDNLGVYGLVFLVSVFGVSDLIFPNVNVVAHIGGILGGIMYAVVYYLIRSGRTIK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	214 (176)
Sequences:	6449 (4831)
Seq/√Len:	364.2

ECOLI - GLPG
BACSU - GLUP YDCA
HALSA - Q9HS82
SULSO - Q97ZW2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
82_I	121_G	5.713	1.00
120_A	147_G	5.180	1.00
123_L	196_G	3.932	1.00
81_S	125_N	3.375	1.00
86_N	139_S	3.296	1.00
74_Y	77_E	3.254	1.00
121_G	144_G	3.220	1.00
128_T	186_N	2.975	1.00
43_T	91_F	2.702	1.00
35_T	114_Y	2.666	1.00
127_L	192_G	2.578	1.00
88_F	92_I	2.525	1.00
150_S	194_I	2.379	1.00
39_M	95_F	2.363	1.00
42_V	117_F	2.351	1.00
128_T	138_S	2.286	1.00
138_S	186_N	2.067	1.00
39_M	99_Y	2.029	1.00
66_L	69_L	2.026	1.00
42_V	95_F	2.025	1.00
64_E	137_L	1.760	1.00
154_F	198_I	1.732	1.00
96_I	100_V	1.722	1.00
116_I	120_A	1.695	1.00
34_S	115_G	1.682	1.00
34_S	111_K	1.630	1.00
179_D	187_V	1.629	1.00
116_I	151_Y	1.600	1.00
93_F	97_S	1.594	1.00
35_T	106_G	1.535	1.00
124_G	143_G	1.510	1.00
117_F	144_G	1.494	1.00
151_Y	201_A	1.491	1.00
175_F	179_D	1.467	1.00
39_M	42_V	1.449	1.00
58_T	62_Y	1.438	1.00
65_Q	70_V	1.417	1.00
154_F	201_A	1.360	1.00
98_L	145_I	1.350	1.00
79_F	122_I	1.343	1.00
143_G	189_A	1.339	1.00
38_L	42_V	1.319	1.00
98_L	102_Y	1.286	1.00
188_V	192_G	1.285	1.00
109_A	116_I	1.271	1.00
33_I	111_K	1.270	1.00
81_S	138_S	1.265	1.00
103_L	107_S	1.251	1.00
131_F	188_V	1.209	1.00
65_Q	129_V	1.199	1.00
65_Q	125_N	1.175	1.00
85_T	90_D	1.173	1.00
146_F	175_F	1.166	1.00
71_I	129_V	1.152	1.00
59_S	63_L	1.151	1.00
64_E	139_S	1.149	1.00
196_G	200_Y	1.143	1.00
70_V	73_G	1.142	1.00
94_N	142_S	1.115	1.00
117_F	141_A	1.115	1.00
46_F	91_F	1.114	1.00
82_I	144_G	1.108	1.00
36_F	40_F	1.105	1.00
60_L	64_E	1.090	1.00
186_N	189_A	1.088	1.00
173_S	177_V	1.085	1.00
39_M	43_T	1.085	1.00
177_V	181_I	1.085	1.00
120_A	196_G	1.073	1.00
37_F	41_L	1.064	1.00
90_D	142_S	1.061	1.00
97_S	145_I	1.048	1.00
94_N	190_H	1.043	1.00
124_G	192_G	1.039	1.00
78_L	125_N	1.033	1.00
142_S	190_H	1.030	1.00
57_S	61_Y	1.012	1.00
58_T	61_Y	1.005	1.00
42_V	83_F	1.004	1.00
76_S	80_T	0.999	1.00
172_V	175_F	0.996	1.00
153_T	172_V	0.992	1.00
95_F	98_L	0.975	1.00
84_I	139_S	0.975	1.00
62_Y	66_L	0.972	1.00
97_S	100_V	0.965	1.00
157_F	161_D	0.958	1.00
169_V	173_S	0.949	1.00
43_T	95_F	0.947	1.00
124_G	147_G	0.944	1.00
154_F	202_V	0.939	1.00
92_I	96_I	0.937	1.00
33_I	36_F	0.934	1.00
78_L	129_V	0.934	1.00
82_I	122_I	0.914	1.00
102_Y	106_G	0.910	1.00
47_M	51_L	0.907	1.00
87_S	139_S	0.904	1.00
40_F	44_L	0.900	1.00
79_F	82_I	0.881	1.00
170_F	174_V	0.881	1.00
125_N	143_G	0.879	1.00
61_Y	64_E	0.879	1.00
150_S	198_I	0.876	1.00
46_F	49_G	0.864	1.00
176_G	191_I	0.863	1.00
123_L	127_L	0.861	1.00
127_L	131_F	0.860	1.00
200_Y	204_Y	0.857	1.00
202_V	205_Y	0.857	1.00
119_L	200_Y	0.851	1.00
90_D	94_N	0.842	1.00
83_F	118_I	0.842	1.00
32_G	36_F	0.841	1.00
114_Y	117_F	0.836	1.00
77_E	80_T	0.832	1.00
46_F	50_L	0.829	1.00
125_N	138_S	0.829	1.00
45_G	84_I	0.823	1.00
38_L	115_G	0.821	1.00
44_L	48_V	0.820	1.00
198_I	202_V	0.817	1.00
170_F	173_S	0.817	1.00
150_S	201_A	0.816	1.00
123_L	192_G	0.808	1.00
106_G	110_G	0.808	1.00
167_G	175_F	0.807	1.00
82_I	125_N	0.806	1.00
79_F	83_F	0.804	1.00
90_D	190_H	0.802	1.00
42_V	46_F	0.800	1.00
127_L	188_V	0.800	1.00
31_I	36_F	0.798	1.00
119_L	196_G	0.789	1.00
36_F	99_Y	0.789	1.00
118_I	122_I	0.787	1.00
141_A	144_G	0.785	1.00
38_L	117_F	0.782	1.00
174_V	177_V	0.782	1.00
45_G	49_G	0.779	1.00
38_L	98_L	0.770	1.00
167_G	170_F	0.768	1.00
49_G	62_Y	0.764	1.00
89_V	93_F	0.763	1.00
107_S	111_K	0.761	1.00
33_I	37_F	0.760	1.00
60_L	63_L	0.758	1.00
63_L	66_L	0.754	1.00
105_F	151_Y	0.752	1.00
108_R	156_D	0.744	1.00
49_G	84_I	0.740	1.00
115_G	118_I	0.738	1.00
171_L	175_F	0.732	1.00
198_I	201_A	0.731	1.00
63_L	84_I	0.727	1.00
169_V	172_V	0.726	1.00
160_K	166_Y	0.725	1.00
116_I	201_A	0.724	1.00
34_S	37_F	0.724	1.00
162_N	166_Y	0.721	1.00
110_G	113_E	0.714	0.99
89_V	92_I	0.713	0.99
176_G	194_I	0.711	0.99
122_I	126_L	0.707	0.99
39_M	98_L	0.704	0.99
41_L	45_G	0.700	0.99
162_N	165_V	0.699	0.99
152_Y	168_L	0.698	0.99
43_T	88_F	0.698	0.99
82_I	117_F	0.695	0.99
75_Y	79_F	0.692	0.99
146_F	179_D	0.690	0.99
34_S	114_Y	0.685	0.99
78_L	122_I	0.681	0.99
202_V	206_L	0.681	0.99
43_T	47_M	0.679	0.99
46_F	87_S	0.677	0.99
170_F	177_V	0.676	0.99
161_D	164_G	0.674	0.99
42_V	49_G	0.664	0.99
62_Y	76_S	0.664	0.99
106_G	111_K	0.663	0.99
50_L	53_T	0.658	0.99
120_A	124_G	0.655	0.99
91_F	95_F	0.653	0.99
64_E	68_Y	0.652	0.99
49_G	52_A	0.651	0.99
64_E	67_N	0.651	0.99
192_G	196_G	0.651	0.99
117_F	148_L	0.650	0.99
65_Q	186_N	0.649	0.99
179_D	194_I	0.646	0.99
175_F	178_S	0.644	0.99
98_L	117_F	0.642	0.99
119_L	123_L	0.632	0.99
104_I	107_S	0.630	0.99
138_S	188_V	0.629	0.99
62_Y	69_L	0.625	0.99
105_F	109_A	0.621	0.99
81_S	143_G	0.620	0.99
97_S	149_L	0.616	0.98
75_Y	78_L	0.614	0.98
79_F	118_I	0.614	0.98
199_M	202_V	0.614	0.98
128_T	132_Y	0.612	0.98
94_N	141_A	0.610	0.98
109_A	114_Y	0.610	0.98
158_L	169_V	0.608	0.98
63_L	67_N	0.606	0.98
120_A	201_A	0.604	0.98
49_G	53_T	0.595	0.98
93_F	100_V	0.592	0.98
122_I	125_N	0.592	0.98
151_Y	155_Y	0.592	0.98
104_I	152_Y	0.591	0.98
138_S	189_A	0.590	0.98
163_L	166_Y	0.587	0.98
124_G	127_L	0.586	0.98
121_G	124_G	0.580	0.98
109_A	155_Y	0.571	0.98
109_A	151_Y	0.569	0.97
72_K	75_Y	0.569	0.97
83_F	117_F	0.564	0.97
116_I	200_Y	0.564	0.97
123_L	147_G	0.563	0.97
191_I	195_L	0.561	0.97
149_L	168_L	0.559	0.97
70_V	129_V	0.556	0.97
119_L	124_G	0.555	0.97
49_G	60_L	0.553	0.97
78_L	81_S	0.550	0.97
61_Y	67_N	0.545	0.97
61_Y	66_L	0.538	0.96
158_L	167_G	0.537	0.96
154_F	199_M	0.536	0.96
157_F	160_K	0.535	0.96
101_I	152_Y	0.534	0.96
118_I	121_G	0.534	0.96
68_Y	72_K	0.533	0.96
104_I	159_K	0.532	0.96
97_S	101_I	0.531	0.96
97_S	197_G	0.530	0.96
101_I	148_L	0.529	0.96
199_M	203_V	0.527	0.96
36_F	39_M	0.527	0.96
42_V	82_I	0.527	0.96
128_T	188_V	0.526	0.96
37_F	40_F	0.526	0.96
132_Y	136_T	0.523	0.96
89_V	178_S	0.522	0.96
102_Y	114_Y	0.521	0.96
42_V	45_G	0.520	0.96
46_F	86_N	0.516	0.96
176_G	179_D	0.513	0.95
112_H	115_G	0.510	0.95
95_F	117_F	0.510	0.95
68_Y	71_I	0.508	0.95
147_G	196_G	0.506	0.95
174_V	178_S	0.505	0.95
59_S	62_Y	0.502	0.95
43_T	46_F	0.502	0.95
89_V	96_I	0.501	0.95
85_T	142_S	0.501	0.95
142_S	193_G	0.500	0.95

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4njnA	4	0.8178	100	0.346	Contact Map
2nr9A	2	0.8598	100	0.349	Contact Map
2xovA	1	0.8131	100	0.382	Contact Map
4j05A	3	0.7664	56.8	0.922	Contact Map
4ytpC	1	0.5748	50	0.925	Contact Map
3o7qA	1	0.8925	35	0.931	Contact Map
4oh3A	2	0.8925	27.6	0.935	Contact Map
2cfqA	1	0.9393	26.1	0.935	Contact Map
2kogA	1	0.2477	25	0.936	Contact Map
4zw9A	1	0.8505	21.9	0.938	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.