Q97ZW1 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97ZW1 - Uncharacterized protein

UniProt:	Q97ZW1	Sequences: MSWDIRYLEWRFANLNEITSFLLAALSLAVAYIRPTSILSDPIGSIIIPYIVALLAIIPHEIGHRQAARRYGCFSRFTLSFSGFWTTLILNIIGSFVGILVFFSGYTSISCGLLNRDVEGKTALAGPLTNIIVGFVGLIGASLVPFSLVGLFFFELARFNFWVAFFNLLPFWVLDGLKIFRWNMIVWAVLIIIAFALTFL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	200 (157)
Sequences:	1721 (1237)
Seq/√Len:	98.7

BACSU - YWHC
SULSO - Q97ZW1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
131_I	164_A	5.487	1.00
137_G	156_L	4.618	1.00
59_P	129_T	3.172	1.00
68_A	112_G	2.837	1.00
67_A	121_K	2.569	1.00
74_F	111_C	2.557	1.00
95_S	98_G	2.414	1.00
190_L	194_A	2.352	1.00
124_L	179_I	2.144	1.00
60_H	64_H	2.119	1.00
62_I	66_Q	2.119	1.00
66_Q	70_R	2.106	1.00
109_I	112_G	2.067	1.00
86_T	91_N	2.042	1.00
134_G	161_F	2.024	1.00
71_Y	118_V	1.969	1.00
62_I	79_L	1.953	1.00
172_W	177_L	1.942	1.00
62_I	65_R	1.913	1.00
71_Y	121_K	1.913	1.00
124_L	128_L	1.874	1.00
91_N	95_S	1.808	1.00
117_D	121_K	1.798	1.00
63_G	129_T	1.793	1.00
188_A	191_I	1.674	1.00
114_L	117_D	1.661	1.00
58_I	62_I	1.657	1.00
183_N	186_V	1.639	1.00
52_V	56_A	1.637	1.00
76_R	106_Y	1.631	1.00
107_T	119_E	1.628	1.00
61_E	64_H	1.577	1.00
178_K	185_I	1.562	1.00
93_I	97_V	1.555	1.00
129_T	133_V	1.514	1.00
66_Q	69_R	1.512	1.00
52_V	156_L	1.462	1.00
120_G	124_L	1.404	1.00
168_L	179_I	1.400	1.00
112_G	122_T	1.390	0.99
123_A	178_K	1.385	0.99
128_L	132_I	1.371	0.99
65_R	79_L	1.361	0.99
115_N	118_V	1.361	0.99
60_H	175_D	1.327	0.99
189_V	192_I	1.317	0.99
119_E	123_A	1.268	0.99
84_F	88_L	1.265	0.99
52_V	152_F	1.229	0.99
88_L	93_I	1.211	0.99
71_Y	120_G	1.201	0.98
56_A	133_V	1.185	0.98
189_V	193_I	1.184	0.98
158_R	162_W	1.183	0.98
137_G	157_A	1.176	0.98
69_R	74_F	1.167	0.98
60_H	126_G	1.154	0.98
185_I	188_A	1.151	0.98
64_H	126_G	1.147	0.98
61_E	175_D	1.141	0.98
93_I	98_G	1.138	0.98
159_F	163_V	1.138	0.98
133_V	156_L	1.136	0.98
114_L	118_V	1.135	0.98
61_E	167_N	1.132	0.98
64_H	167_N	1.131	0.98
65_R	69_R	1.129	0.98
120_G	123_A	1.121	0.98
49_P	155_E	1.121	0.98
133_V	137_G	1.112	0.97
161_F	165_F	1.100	0.97
120_G	127_P	1.097	0.97
152_F	156_L	1.091	0.97
137_G	153_F	1.088	0.97
64_H	102_F	1.073	0.97
138_L	157_A	1.070	0.97
89_I	93_I	1.027	0.96
64_H	175_D	1.023	0.96
119_E	178_K	1.016	0.96
184_M	191_I	1.009	0.95
167_N	175_D	0.997	0.95
60_H	167_N	0.993	0.95
153_F	156_L	0.982	0.95
47_I	51_I	0.981	0.95
86_T	95_S	0.980	0.95
64_H	125_A	0.978	0.95
54_L	58_I	0.976	0.95
56_A	160_N	0.964	0.94
89_I	94_G	0.961	0.94
48_I	155_E	0.959	0.94
107_T	112_G	0.943	0.94
90_L	101_V	0.940	0.93
60_H	105_G	0.918	0.93
61_E	130_N	0.900	0.92
94_G	101_V	0.889	0.91
59_P	133_V	0.875	0.91
87_T	103_F	0.875	0.91
177_L	181_R	0.874	0.91
67_A	70_R	0.874	0.91
52_V	137_G	0.870	0.90
73_C	83_G	0.864	0.90
44_G	47_I	0.853	0.90
154_F	158_R	0.852	0.90
80_S	83_G	0.848	0.89
68_A	111_C	0.841	0.89
188_A	195_F	0.838	0.89
188_A	192_I	0.834	0.89
64_H	130_N	0.830	0.88
141_A	150_G	0.827	0.88
134_G	157_A	0.825	0.88
184_M	188_A	0.823	0.88
48_I	148_L	0.823	0.88
64_H	105_G	0.820	0.88
85_W	90_L	0.819	0.88
120_G	178_K	0.817	0.88
73_C	100_L	0.814	0.87
193_I	196_A	0.814	0.87
130_N	160_N	0.802	0.87
43_I	47_I	0.791	0.86
60_H	102_F	0.791	0.86
73_C	82_S	0.790	0.86
49_P	159_F	0.786	0.85
65_R	106_Y	0.786	0.85
132_I	136_V	0.770	0.84
78_T	163_V	0.769	0.84
115_N	119_E	0.769	0.84
42_P	46_I	0.764	0.84
151_L	154_F	0.763	0.84
58_I	65_R	0.763	0.84
126_G	175_D	0.760	0.83
135_F	139_I	0.759	0.83
42_P	45_S	0.754	0.83
73_C	85_W	0.744	0.82
67_A	125_A	0.744	0.82
53_A	159_F	0.741	0.82
140_G	151_L	0.740	0.82
166_F	174_L	0.738	0.82
145_P	148_L	0.738	0.82
78_T	85_W	0.737	0.82
182_W	186_V	0.729	0.81
147_S	151_L	0.719	0.80
61_E	102_F	0.717	0.80
130_N	167_N	0.716	0.80
89_I	101_V	0.712	0.79
91_N	98_G	0.710	0.79
48_I	151_L	0.708	0.79
70_R	117_D	0.705	0.79
59_P	81_F	0.700	0.78
131_I	168_L	0.700	0.78
73_C	81_F	0.696	0.78
87_T	100_L	0.691	0.77
164_A	168_L	0.687	0.77
51_I	54_L	0.677	0.76
144_V	148_L	0.673	0.75
172_W	184_M	0.671	0.75
78_T	90_L	0.669	0.75
86_T	92_I	0.668	0.75
172_W	181_R	0.668	0.75
90_L	100_L	0.658	0.74
184_M	189_V	0.656	0.74
148_L	152_F	0.655	0.73
174_L	178_K	0.650	0.73
64_H	174_L	0.637	0.71
186_V	189_V	0.636	0.71
59_P	67_A	0.634	0.71
126_G	167_N	0.634	0.71
132_I	139_I	0.630	0.70
117_D	124_L	0.629	0.70
179_I	183_N	0.621	0.69
143_L	150_G	0.615	0.69
65_R	73_C	0.614	0.69
118_V	122_T	0.610	0.68
92_I	95_S	0.609	0.68
53_A	86_T	0.606	0.68
57_I	95_S	0.606	0.68
186_V	191_I	0.605	0.67
77_F	80_S	0.602	0.67
73_C	77_F	0.601	0.67
145_P	151_L	0.597	0.66
187_W	191_I	0.596	0.66
63_G	67_A	0.589	0.65
192_I	196_A	0.589	0.65
187_W	192_I	0.587	0.65
73_C	90_L	0.586	0.65
86_T	102_F	0.585	0.65
146_F	150_G	0.585	0.65
182_W	191_I	0.585	0.65
171_F	188_A	0.585	0.65
71_Y	127_P	0.583	0.65
161_F	197_L	0.582	0.64
142_S	146_F	0.581	0.64
141_A	147_S	0.578	0.64
130_N	166_F	0.573	0.63
44_G	171_F	0.566	0.62
185_I	191_I	0.566	0.62
85_W	100_L	0.565	0.62
155_E	159_F	0.564	0.62
62_I	80_S	0.560	0.61
148_L	151_L	0.560	0.61
61_E	126_G	0.558	0.61
144_V	147_S	0.558	0.61
182_W	185_I	0.557	0.61
193_I	197_L	0.546	0.60
88_L	187_W	0.546	0.60
117_D	120_G	0.542	0.59
66_Q	120_G	0.540	0.59
78_T	87_T	0.538	0.58
111_C	114_L	0.537	0.58
52_V	155_E	0.534	0.58
76_R	79_L	0.530	0.57
115_N	127_P	0.527	0.57
147_S	197_L	0.527	0.57
89_I	150_G	0.525	0.57
124_L	127_P	0.524	0.56
51_I	148_L	0.524	0.56
62_I	98_G	0.521	0.56
108_S	111_C	0.520	0.56
101_V	108_S	0.519	0.56
127_P	179_I	0.517	0.55
129_T	168_L	0.513	0.55
45_S	49_P	0.513	0.55
110_S	149_V	0.510	0.54
152_F	155_E	0.510	0.54
51_I	151_L	0.509	0.54
93_I	96_F	0.508	0.54
141_A	154_F	0.507	0.54
138_L	142_S	0.504	0.54
55_L	59_P	0.504	0.54
57_I	94_G	0.503	0.53
99_I	162_W	0.503	0.53
90_L	105_G	0.502	0.53
51_I	155_E	0.502	0.53
87_T	90_L	0.502	0.53
59_P	63_G	0.501	0.53
82_S	100_L	0.500	0.53
118_V	194_A	0.500	0.53

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3b4rA	2	0.85	99.9	0.593	Contact Map
4b03D	5	0.28	5.7	0.959	Contact Map
3rceA	1	0.875	3.3	0.964	Contact Map
4av3A	2	0.82	2.9	0.965	Contact Map
4czbA	2	0.38	2.6	0.965	Contact Map
3ovuB	1	0.265	2.3	0.966	Contact Map
2wwbC	1	0.18	2.2	0.967	Contact Map
3j01B	1	0.23	1.8	0.969	Contact Map
3g2mA	2	0.265	1.7	0.969	Contact Map
4bptA	1	0.215	1.7	0.969	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.