Q97ZU8 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97ZU8 - Uncharacterized protein

UniProt:	Q97ZU8	Sequences: MYRRKPNPYVKLINGDKIIDVGCGSGQNCDQFKGRLVICLDLSLNQLNQARKKGCQNLVQADMEYLPFRDSSVDSLAYIASLHHLRDPSQALGEAQRVLKDKGEILVTVWLVQLKFFFLRRYIIKRSLINGKEVRRFYRLYYPWELKRIMESKGFVTKIYKLYRVNSLLPNNSLYYGIKSTA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	182 (152)
Sequences:	11109 (8036)
Seq/√Len:	651.8

ECOLI - UBIG UBIE SMTA TAM BIOC YJHP CMOA TEHB YAFE CMOB RLMA YAFS
BACSU - YBAJ MENG YXBB YRRT YCGJ YDAC YRHH YODH YQEM YXJB
HALSA - Q9HR81 Q9HND6 Q9HMT2 Q9HSK6 ARSM Q9HR63 Q9HRX3 Q9HQ85
SULSO - Q97ZU8 Q7LXN7 Q97X57 Q97WT7 Q97WH3 Q97XD7 Q97YX4 Q97WN4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
44_L	60_Q	2.776	1.00
17_K	36_L	2.723	1.00
68_F	73_V	2.580	1.00
96_Q	155_F	2.555	1.00
40_L	61_A	2.520	1.00
61_A	67_P	2.140	1.00
76_L	95_A	2.137	1.00
22_G	81_S	2.119	1.00
94_E	97_R	2.107	1.00
44_L	48_N	2.061	1.00
23_C	39_C	2.028	1.00
95_A	105_I	2.005	1.00
30_D	54_G	1.983	1.00
76_L	99_L	1.960	1.00
89_S	152_S	1.945	1.00
19_I	73_V	1.933	1.00
21_V	95_A	1.930	1.00
87_D	90_Q	1.889	1.00
21_V	63_M	1.798	1.00
47_L	60_Q	1.797	1.00
23_C	29_C	1.786	1.00
29_C	37_V	1.782	1.00
88_P	149_I	1.773	1.00
36_L	57_N	1.753	1.00
85_L	91_A	1.715	1.00
59_V	68_F	1.701	1.00
147_K	151_E	1.689	1.00
99_L	105_I	1.681	1.00
38_I	73_V	1.677	1.00
47_L	58_L	1.647	1.00
142_Y	145_E	1.636	1.00
50_A	58_L	1.636	1.00
54_G	58_L	1.623	1.00
18_I	32_F	1.621	1.00
49_Q	52_K	1.605	1.00
99_L	103_G	1.589	1.00
74_D	100_K	1.585	1.00
17_K	38_I	1.560	1.00
30_D	53_K	1.520	1.00
81_S	85_L	1.516	1.00
69_R	72_S	1.492	1.00
94_E	98_V	1.484	1.00
18_I	75_S	1.456	1.00
42_L	62_D	1.437	1.00
70_D	97_R	1.431	1.00
99_L	155_F	1.409	1.00
89_S	93_G	1.398	1.00
66_L	98_V	1.395	1.00
17_K	73_V	1.381	1.00
16_D	75_S	1.373	1.00
38_I	59_V	1.354	1.00
89_S	149_I	1.322	1.00
29_C	39_C	1.298	1.00
90_Q	93_G	1.284	1.00
22_G	78_Y	1.270	1.00
17_K	100_K	1.228	1.00
32_F	77_A	1.197	1.00
148_R	152_S	1.195	1.00
48_N	51_R	1.189	1.00
29_C	58_L	1.172	1.00
39_C	58_L	1.158	1.00
38_I	68_F	1.143	1.00
17_K	72_S	1.137	1.00
62_D	65_Y	1.125	1.00
13_I	16_D	1.118	1.00
63_M	85_L	1.105	1.00
92_L	150_M	1.089	1.00
39_C	50_A	1.079	1.00
66_L	94_E	1.075	1.00
63_M	81_S	1.075	1.00
25_S	46_Q	1.072	1.00
16_D	35_R	1.067	1.00
116_F	120_R	1.066	1.00
41_D	47_L	1.066	1.00
26_G	50_A	1.061	1.00
84_H	109_V	1.044	1.00
15_G	35_R	1.039	1.00
148_R	151_E	1.028	1.00
19_I	76_L	1.027	1.00
80_A	83_H	1.018	1.00
91_A	95_A	1.015	1.00
76_L	98_V	1.007	1.00
71_S	101_D	0.984	1.00
65_Y	90_Q	0.978	1.00
19_I	98_V	0.976	1.00
64_E	85_L	0.976	1.00
147_K	160_Y	0.974	1.00
121_R	125_K	0.967	1.00
43_S	46_Q	0.964	1.00
38_I	57_N	0.957	1.00
105_I	150_M	0.951	1.00
83_H	109_V	0.945	1.00
89_S	153_K	0.938	1.00
45_N	48_N	0.934	1.00
82_L	85_L	0.931	1.00
20_D	23_C	0.916	1.00
40_L	59_V	0.911	1.00
40_L	66_L	0.908	1.00
78_Y	81_S	0.907	1.00
12_L	16_D	0.905	1.00
124_I	127_S	0.903	1.00
26_G	58_L	0.898	1.00
112_V	142_Y	0.894	1.00
79_I	108_T	0.887	1.00
93_G	153_K	0.880	1.00
122_Y	125_K	0.878	1.00
21_V	76_L	0.864	1.00
117_F	120_R	0.863	1.00
80_A	84_H	0.854	1.00
27_Q	53_K	0.845	1.00
23_C	50_A	0.839	1.00
95_A	99_L	0.834	1.00
80_A	108_T	0.824	1.00
28_N	79_I	0.820	1.00
78_Y	85_L	0.819	1.00
9_Y	12_L	0.817	1.00
145_E	148_R	0.817	1.00
51_R	55_C	0.815	1.00
107_V	150_M	0.812	1.00
18_I	37_V	0.810	1.00
134_V	137_F	0.794	1.00
92_L	153_K	0.790	1.00
68_F	98_V	0.789	1.00
64_E	87_D	0.783	1.00
48_N	52_K	0.780	1.00
22_G	85_L	0.777	1.00
82_L	92_L	0.775	1.00
52_K	56_Q	0.775	1.00
41_D	46_Q	0.769	1.00
70_D	94_E	0.767	1.00
25_S	53_K	0.767	1.00
10_V	75_S	0.765	1.00
78_Y	107_V	0.763	1.00
126_R	129_I	0.763	1.00
92_L	146_L	0.758	1.00
83_H	110_W	0.730	1.00
30_D	55_C	0.723	1.00
125_K	128_L	0.721	1.00
124_I	128_L	0.719	1.00
49_Q	53_K	0.717	1.00
45_N	49_Q	0.710	1.00
123_I	126_R	0.703	1.00
64_E	91_A	0.703	1.00
123_I	127_S	0.701	1.00
21_V	40_L	0.698	1.00
80_A	110_W	0.695	1.00
64_E	86_R	0.694	1.00
82_L	107_V	0.693	1.00
122_Y	127_S	0.684	1.00
20_D	40_L	0.683	1.00
15_G	34_G	0.667	1.00
65_Y	94_E	0.661	1.00
16_D	104_E	0.661	1.00
51_R	54_G	0.661	1.00
25_S	49_Q	0.661	1.00
151_E	158_K	0.652	1.00
17_K	74_D	0.651	1.00
122_Y	126_R	0.650	1.00
67_P	94_E	0.647	1.00
82_L	146_L	0.647	1.00
44_L	51_R	0.644	1.00
110_W	137_F	0.642	1.00
14_N	34_G	0.642	1.00
28_N	77_A	0.641	1.00
118_F	122_Y	0.641	1.00
68_F	72_S	0.641	1.00
47_L	51_R	0.640	1.00
84_H	110_W	0.640	1.00
130_N	133_E	0.634	1.00
20_D	37_V	0.634	1.00
131_G	134_V	0.632	1.00
64_E	90_Q	0.629	1.00
23_C	47_L	0.626	1.00
71_S	100_K	0.625	1.00
52_K	55_C	0.622	1.00
118_F	121_R	0.617	1.00
96_Q	153_K	0.610	1.00
90_Q	94_E	0.610	1.00
125_K	129_I	0.604	1.00
135_R	138_Y	0.602	1.00
19_I	68_F	0.602	1.00
42_L	64_E	0.599	1.00
21_V	91_A	0.597	1.00
16_D	74_D	0.595	1.00
93_G	152_S	0.592	1.00
132_K	136_R	0.588	1.00
81_S	84_H	0.584	1.00
109_V	146_L	0.583	1.00
105_I	155_F	0.578	1.00
22_G	42_L	0.578	1.00
133_E	137_F	0.573	1.00
116_F	119_L	0.573	1.00
17_K	35_R	0.567	1.00
150_M	155_F	0.562	1.00
121_R	124_I	0.559	1.00
42_L	60_Q	0.559	1.00
92_L	149_I	0.558	1.00
75_S	103_G	0.558	1.00
144_W	147_K	0.557	1.00
134_V	138_Y	0.556	1.00
79_I	83_H	0.548	1.00
63_M	91_A	0.547	1.00
9_Y	159_I	0.546	1.00
28_N	31_Q	0.546	1.00
20_D	77_A	0.545	1.00
28_N	80_A	0.543	1.00
96_Q	99_L	0.538	1.00
144_W	160_Y	0.538	1.00
136_R	139_R	0.537	1.00
20_D	39_C	0.536	1.00
130_N	134_V	0.535	1.00
122_Y	128_L	0.534	1.00
40_L	68_F	0.533	0.99
27_Q	31_Q	0.530	0.99
151_E	157_T	0.527	0.99
120_R	123_I	0.520	0.99
27_Q	30_D	0.519	0.99
124_I	129_I	0.517	0.99
38_I	72_S	0.514	0.99
23_C	58_L	0.513	0.99
53_K	56_Q	0.511	0.99
119_L	123_I	0.510	0.99
12_L	35_R	0.509	0.99
82_L	91_A	0.505	0.99
46_Q	80_A	0.504	0.99
111_L	114_L	0.502	0.99
18_I	77_A	0.500	0.99
131_G	135_R	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4obxA	2	0.956	100	0.402	Contact Map
4pneA	2	0.9505	100	0.404	Contact Map
4ineA	2	0.956	100	0.409	Contact Map
2o57A	2	0.9615	100	0.412	Contact Map
3ujcA	1	0.9615	100	0.412	Contact Map
4kriA	1	0.956	100	0.414	Contact Map
4kdcA	1	0.9396	100	0.414	Contact Map
3e8sA	2	0.989	100	0.416	Contact Map
3bkxA	2	0.9945	100	0.418	Contact Map
3busA	1	0.978	100	0.42	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.