Q97ZU6 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97ZU6 - Uncharacterized protein

UniProt:	Q97ZU6	Sequences: MRKAVIFDLDGTLANTDEVHKLAWEIALRKLGYDVKVDIRYLLGRKTIDIAKILIGESHAEKLASVKTEIYNELVKTLAKPKPCVMELINRLRDVEIPIAVVTSSMRNSAVQVLKVINVEPDVLITGDDVKLGKPNPMPVIEAIKRLNVDPNESVGVGDTIYDVMAYYSAGIREIIVVRSSVPLNVEEARKYDAKILDSLCEISDWFELF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	210 (198)
Sequences:	27825 (21904)
Seq/√Len:	1556.7

ECOLI - GPH YFBT YNIC YIEH PGMB YRFG YJJG YIGB YQAB YIHX
BACSU - YHCW PPAX YSAA YFNB PGMB
HALSA - Q9HSS2 Q9HQE2 Q9HP74 Q9HMC4
SULSO - Q97ZU6 Q7LXL6 Q7LX46 Q97WT6 Q97X58 Q97YZ1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
3_K	153_E	4.273	1.00
132_L	136_N	2.928	1.00
142_E	146_R	2.878	1.00
115_K	120_E	2.856	1.00
167_Y	174_E	2.684	1.00
107_R	111_V	2.653	1.00
4_A	149_V	2.485	1.00
158_G	163_D	2.432	1.00
86_M	90_N	2.328	1.00
142_E	145_K	2.300	1.00
102_V	139_P	2.188	1.00
132_L	138_M	2.172	1.00
7_F	99_I	2.162	1.00
144_I	154_S	2.135	1.00
98_P	122_D	2.108	1.00
107_R	129_D	2.097	1.00
164_V	174_E	2.065	1.00
168_Y	194_A	2.057	1.00
198_D	202_E	2.051	1.00
30_K	66_V	2.019	1.00
103_T	110_A	1.978	1.00
173_R	194_A	1.962	1.00
165_M	169_S	1.937	1.00
123_V	146_R	1.924	1.00
100_A	123_V	1.922	1.00
91_R	95_V	1.905	1.00
150_D	153_E	1.857	1.00
26_I	70_I	1.854	1.00
5_V	97_I	1.842	1.00
156_G	167_Y	1.780	1.00
155_V	175_I	1.725	1.00
144_I	172_I	1.720	1.00
85_V	200_L	1.654	1.00
93_R	122_D	1.639	1.00
6_I	143_A	1.617	1.00
6_I	156_G	1.604	1.00
4_A	147_L	1.600	1.00
149_V	154_S	1.574	1.00
178_V	198_D	1.562	1.00
144_I	151_P	1.530	1.00
6_I	102_V	1.526	1.00
111_V	120_E	1.516	1.00
31_L	66_V	1.476	1.00
175_I	197_L	1.440	1.00
5_V	157_V	1.415	1.00
100_A	147_L	1.411	1.00
82_K	179_R	1.395	1.00
5_V	92_L	1.394	1.00
70_I	73_E	1.379	1.00
185_N	189_A	1.377	1.00
178_V	196_I	1.366	1.00
30_K	70_I	1.352	1.00
13_L	85_V	1.349	1.00
12_T	157_V	1.345	1.00
88_L	200_L	1.336	1.00
161_I	165_M	1.326	1.00
9_L	110_A	1.324	1.00
175_I	195_K	1.302	1.00
9_L	14_A	1.293	1.00
91_R	94_D	1.290	1.00
26_I	30_K	1.279	1.00
49_D	52_K	1.273	1.00
59_H	62_K	1.256	1.00
199_S	202_E	1.252	1.00
140_V	156_G	1.250	1.00
111_V	115_K	1.236	1.00
66_V	70_I	1.234	1.00
26_I	74_L	1.233	1.00
74_L	77_T	1.230	1.00
9_L	101_V	1.221	1.00
137_P	141_I	1.221	1.00
140_V	166_A	1.212	1.00
84_C	87_E	1.198	1.00
6_I	154_S	1.191	1.00
66_V	69_E	1.183	1.00
81_P	119_V	1.177	1.00
27_A	31_L	1.173	1.00
87_E	201_C	1.150	1.00
93_R	99_I	1.148	1.00
62_K	66_V	1.146	1.00
70_I	74_L	1.125	1.00
10_D	16_T	1.116	1.00
140_V	172_I	1.112	1.00
154_S	172_I	1.111	1.00
22_L	78_L	1.104	1.00
4_A	98_P	1.089	1.00
102_V	143_A	1.087	1.00
4_A	154_S	1.075	1.00
65_S	69_E	1.070	1.00
22_L	74_L	1.064	1.00
76_K	112_Q	1.063	1.00
118_N	121_P	1.061	1.00
138_M	142_E	1.040	1.00
22_L	26_I	1.030	1.00
112_Q	116_V	1.026	1.00
9_L	105_S	1.018	1.00
125_I	146_R	1.017	1.00
29_R	34_D	1.011	1.00
25_E	29_R	1.010	1.00
110_A	126_T	0.991	1.00
90_N	94_D	0.990	1.00
69_E	73_E	0.987	1.00
141_I	170_A	0.985	1.00
168_Y	174_E	0.984	1.00
186_V	190_R	0.983	1.00
156_G	172_I	0.979	1.00
140_V	158_G	0.970	1.00
141_I	145_K	0.966	1.00
155_V	173_R	0.964	1.00
26_I	29_R	0.958	1.00
164_V	193_D	0.952	1.00
173_R	195_K	0.952	1.00
87_E	90_N	0.948	1.00
84_C	199_S	0.941	1.00
168_Y	192_Y	0.936	1.00
81_P	86_M	0.935	1.00
10_D	105_S	0.931	1.00
90_N	121_P	0.927	1.00
45_R	49_D	0.920	1.00
162_Y	165_M	0.919	1.00
122_D	128_D	0.913	1.00
141_I	151_P	0.910	1.00
143_A	147_L	0.909	1.00
4_A	100_A	0.902	1.00
138_M	141_I	0.894	1.00
47_T	51_A	0.893	1.00
174_E	194_A	0.890	1.00
107_R	126_T	0.887	1.00
28_L	33_Y	0.884	1.00
82_K	177_V	0.884	1.00
151_P	172_I	0.878	1.00
92_L	99_I	0.877	1.00
48_I	52_K	0.869	1.00
185_N	198_D	0.869	1.00
112_Q	115_K	0.866	1.00
49_D	53_I	0.864	1.00
123_V	147_L	0.863	1.00
92_L	97_I	0.863	1.00
52_K	60_A	0.862	1.00
25_E	37_V	0.862	1.00
107_R	128_D	0.862	1.00
6_I	147_L	0.856	1.00
22_L	25_E	0.852	1.00
47_T	50_I	0.850	1.00
131_K	138_M	0.841	1.00
64_A	68_T	0.837	1.00
40_R	43_L	0.837	1.00
67_K	71_Y	0.837	1.00
9_L	113_V	0.833	1.00
157_V	175_I	0.832	1.00
3_K	97_I	0.825	1.00
197_L	203_I	0.822	1.00
53_I	56_G	0.820	1.00
84_C	201_C	0.817	1.00
10_D	103_T	0.813	1.00
46_K	49_D	0.808	1.00
110_A	113_V	0.804	1.00
179_R	200_L	0.802	1.00
14_A	113_V	0.801	1.00
5_V	155_V	0.799	1.00
45_R	53_I	0.793	1.00
52_K	56_G	0.792	1.00
6_I	172_I	0.791	1.00
21_K	25_E	0.791	1.00
164_V	176_I	0.790	1.00
125_I	143_A	0.788	1.00
157_V	203_I	0.786	1.00
14_A	117_I	0.774	1.00
139_P	143_A	0.772	1.00
38_D	41_Y	0.770	1.00
149_V	153_E	0.768	1.00
103_T	126_T	0.766	1.00
100_A	143_A	0.762	1.00
19_V	79_A	0.757	1.00
71_Y	75_V	0.757	1.00
82_K	85_V	0.754	1.00
175_I	203_I	0.754	1.00
166_A	170_A	0.754	1.00
86_M	118_N	0.741	1.00
140_V	163_D	0.736	1.00
51_A	55_I	0.734	1.00
90_N	93_R	0.732	1.00
176_I	196_I	0.725	1.00
74_L	78_L	0.725	1.00
99_I	122_D	0.725	1.00
130_V	142_E	0.723	1.00
188_E	192_Y	0.723	1.00
10_D	159_D	0.722	1.00
63_L	66_V	0.710	1.00
18_E	80_K	0.704	1.00
81_P	117_I	0.699	1.00
188_E	191_K	0.698	1.00
20_H	24_W	0.698	1.00
61_E	65_S	0.698	1.00
114_L	120_E	0.695	1.00
105_S	110_A	0.694	1.00
6_I	100_A	0.690	1.00
86_M	121_P	0.686	1.00
87_E	91_R	0.686	1.00
187_E	190_R	0.685	1.00
126_T	129_D	0.684	1.00
139_P	166_A	0.683	1.00
11_G	17_D	0.682	1.00
55_I	58_S	0.681	1.00
165_M	168_Y	0.680	1.00
23_A	27_A	0.680	1.00
129_D	146_R	0.679	1.00
98_P	149_V	0.674	1.00
3_K	98_P	0.673	1.00
68_T	72_N	0.672	1.00
31_L	62_K	0.671	1.00
65_S	68_T	0.671	1.00
84_C	88_L	0.671	1.00
104_S	133_G	0.670	1.00
62_K	65_S	0.663	1.00
186_V	189_A	0.659	1.00
122_D	126_T	0.655	1.00
3_K	149_V	0.650	1.00
125_I	142_E	0.646	1.00
15_N	80_K	0.644	1.00
60_A	63_L	0.638	1.00
23_A	70_I	0.638	1.00
88_L	157_V	0.630	1.00
156_G	166_A	0.629	1.00
125_I	139_P	0.628	1.00
48_I	61_E	0.627	1.00
110_A	114_L	0.625	1.00
53_I	57_E	0.624	1.00
15_N	18_E	0.621	1.00
12_T	177_V	0.618	1.00
177_V	200_L	0.613	1.00
156_G	163_D	0.613	1.00
10_D	113_V	0.610	1.00
111_V	124_L	0.609	1.00
151_P	154_S	0.608	1.00
102_V	156_G	0.606	1.00
63_L	67_K	0.605	1.00
197_L	200_L	0.605	1.00
20_H	105_S	0.604	1.00
20_H	67_K	0.598	1.00
7_F	88_L	0.598	1.00
73_E	77_T	0.598	1.00
114_L	121_P	0.597	1.00
130_V	139_P	0.597	1.00
137_P	169_S	0.593	1.00
16_T	105_S	0.587	1.00
14_A	79_A	0.579	1.00
144_I	149_V	0.576	1.00
115_K	121_P	0.575	1.00
72_N	108_N	0.574	1.00
83_P	201_C	0.574	1.00
21_K	37_V	0.572	1.00
165_M	191_K	0.564	1.00
108_N	112_Q	0.564	1.00
141_I	144_I	0.563	1.00
48_I	60_A	0.562	1.00
144_I	170_A	0.559	1.00
73_E	76_K	0.559	1.00
18_E	22_L	0.558	1.00
37_V	40_R	0.557	1.00
72_N	112_Q	0.557	1.00
104_S	162_Y	0.557	1.00
140_V	167_Y	0.556	1.00
76_K	116_V	0.554	1.00
85_V	88_L	0.549	1.00
104_S	135_P	0.549	1.00
85_V	89_I	0.549	1.00
105_S	158_G	0.549	1.00
110_A	124_L	0.548	1.00
88_L	91_R	0.548	1.00
46_K	50_I	0.547	1.00
24_W	28_L	0.546	1.00
6_I	140_V	0.545	1.00
83_P	199_S	0.543	1.00
176_I	188_E	0.542	1.00
105_S	109_S	0.541	1.00
20_H	71_Y	0.540	1.00
185_N	188_E	0.540	1.00
41_Y	53_I	0.534	1.00
89_I	99_I	0.534	1.00
72_N	76_K	0.533	1.00
31_L	63_L	0.533	1.00
50_I	53_I	0.530	1.00
84_C	179_R	0.528	1.00
13_L	101_V	0.527	1.00
123_V	126_T	0.526	1.00
88_L	92_L	0.524	1.00
162_Y	166_A	0.522	1.00
46_K	51_A	0.519	1.00
127_G	139_P	0.517	1.00
166_A	169_S	0.516	1.00
114_L	119_V	0.515	1.00
27_A	66_V	0.512	1.00
17_D	40_R	0.511	1.00
60_A	64_A	0.507	1.00
27_A	30_K	0.503	1.00
5_V	99_I	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3iruA	4	1	100	0.273	Contact Map
4uw9A	1	0.9238	100	0.275	Contact Map
1swvA	2	1	100	0.277	Contact Map
4eekA	2	0.9952	100	0.288	Contact Map
3qxgA	3	0.9905	100	0.289	Contact Map
1te2A	2	0.9857	100	0.292	Contact Map
2hdoA	1	0.9619	100	0.293	Contact Map
3s6jA	2	0.9905	100	0.293	Contact Map
3mc1A	2	0.9952	100	0.295	Contact Map
4uavA	1	0.9857	100	0.297	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0147 seconds.