Q97ZN6 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97ZN6 - Uncharacterized protein

UniProt:	Q97ZN6	Sequences: MIIKSIRILFKFSYPYTLDLRDMIRILKDLSYVISSNLPLTPPGSMILGSVTALKDDLIVEFNNITGTISFFIQSLDKIDLVEEDFSRIVGNLNLGKIDYIELSLEMILNGKLNLNINMLGGEVVGLEVSSERKNVRINSYMAMANSYSVLITYKLNEIKDLDKVTEEIKRDIQELENKGLR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	182 (143)
Sequences:	920 (758)
Seq/√Len:	63.3

SULSO - Q97ZN6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
134_K	138_I	4.829	1.00
113_L	158_E	4.209	1.00
133_R	136_V	3.355	1.00
99_D	102_E	3.010	1.00
82_V	158_E	2.723	1.00
88_R	100_Y	2.543	1.00
104_S	108_I	2.427	1.00
115_L	119_M	2.286	1.00
134_K	139_N	2.233	1.00
92_N	147_S	2.221	1.00
82_V	87_S	2.205	1.00
75_S	78_K	1.998	1.00
113_L	117_I	1.992	1.00
77_D	160_K	1.935	1.00
48_L	54_L	1.894	1.00
147_S	175_E	1.884	1.00
99_D	104_S	1.857	1.00
41_T	48_L	1.794	1.00
41_T	46_M	1.738	0.99
100_Y	104_S	1.680	0.99
92_N	145_A	1.677	0.99
133_R	138_I	1.657	0.99
52_T	58_L	1.646	0.99
32_Y	39_P	1.607	0.99
54_L	58_L	1.605	0.99
136_V	152_I	1.604	0.99
41_T	52_T	1.587	0.99
82_V	104_S	1.532	0.99
32_Y	41_T	1.528	0.99
41_T	50_S	1.523	0.99
39_P	50_S	1.475	0.98
28_K	32_Y	1.462	0.98
146_N	150_V	1.460	0.98
127_L	130_S	1.459	0.98
96_G	99_D	1.429	0.98
133_R	137_R	1.402	0.98
145_A	175_E	1.399	0.97
46_M	50_S	1.395	0.97
104_S	110_N	1.389	0.97
38_L	41_T	1.372	0.97
93_L	147_S	1.369	0.97
46_M	52_T	1.314	0.96
57_D	61_E	1.296	0.96
146_N	175_E	1.286	0.96
40_L	43_P	1.250	0.95
77_D	106_E	1.246	0.95
32_Y	36_S	1.224	0.95
55_K	59_I	1.214	0.94
101_I	104_S	1.210	0.94
121_G	154_Y	1.206	0.94
102_E	108_I	1.164	0.93
110_N	113_L	1.142	0.92
34_I	41_T	1.138	0.92
73_I	78_K	1.137	0.92
92_N	146_N	1.135	0.92
127_L	152_I	1.134	0.92
32_Y	40_L	1.129	0.92
59_I	63_N	1.125	0.92
106_E	160_K	1.124	0.92
115_L	158_E	1.122	0.92
118_N	157_N	1.112	0.91
134_K	137_R	1.112	0.91
42_P	46_M	1.103	0.91
82_V	156_L	1.095	0.91
35_S	51_V	1.081	0.90
117_I	120_L	1.077	0.90
112_K	115_L	1.076	0.90
80_D	106_E	1.073	0.90
87_S	158_E	1.065	0.89
144_M	147_S	1.060	0.89
113_L	119_M	1.042	0.88
30_L	33_V	1.031	0.88
40_L	44_G	0.997	0.86
163_D	166_T	0.993	0.86
48_L	52_T	0.984	0.85
169_I	172_D	0.983	0.85
136_V	154_Y	0.972	0.84
78_K	154_Y	0.952	0.83
166_T	175_E	0.950	0.83
161_D	164_K	0.938	0.82
39_P	46_M	0.936	0.82
46_M	49_G	0.930	0.82
43_P	46_M	0.930	0.82
28_K	31_S	0.928	0.82
135_N	138_I	0.925	0.81
48_L	58_L	0.923	0.81
170_K	173_I	0.911	0.80
152_I	156_L	0.884	0.78
104_S	115_L	0.881	0.78
44_G	47_I	0.877	0.78
81_L	107_M	0.874	0.78
42_P	48_L	0.865	0.77
78_K	106_E	0.864	0.77
69_I	75_S	0.863	0.77
84_E	87_S	0.861	0.76
40_L	48_L	0.858	0.76
96_G	100_Y	0.847	0.75
50_S	54_L	0.836	0.74
78_K	107_M	0.834	0.74
151_L	173_I	0.833	0.74
77_D	80_D	0.832	0.74
99_D	108_I	0.831	0.74
29_D	32_Y	0.830	0.74
130_S	133_R	0.823	0.73
78_K	160_K	0.816	0.73
71_F	78_K	0.814	0.72
77_D	162_L	0.812	0.72
44_G	53_A	0.809	0.72
32_Y	38_L	0.807	0.72
35_S	93_L	0.805	0.72
40_L	52_T	0.805	0.72
50_S	71_F	0.804	0.71
40_L	74_Q	0.793	0.70
50_S	57_D	0.790	0.70
38_L	46_M	0.789	0.70
75_S	106_E	0.788	0.70
147_S	152_I	0.788	0.70
75_S	108_I	0.779	0.69
80_D	160_K	0.775	0.69
66_T	121_G	0.767	0.68
127_L	136_V	0.766	0.68
112_K	117_I	0.763	0.67
77_D	110_N	0.757	0.67
55_K	61_E	0.742	0.65
31_S	35_S	0.738	0.65
50_S	56_D	0.738	0.65
127_L	154_Y	0.722	0.63
34_I	37_N	0.721	0.63
41_T	54_L	0.716	0.62
77_D	108_I	0.705	0.61
58_L	78_K	0.705	0.61
124_V	139_N	0.701	0.61
126_G	129_V	0.700	0.61
93_L	138_I	0.692	0.60
150_V	154_Y	0.692	0.60
167_E	172_D	0.687	0.59
155_K	167_E	0.678	0.58
31_S	34_I	0.675	0.58
60_V	63_N	0.673	0.58
32_Y	43_P	0.660	0.56
131_S	149_S	0.659	0.56
90_V	138_I	0.657	0.56
35_S	66_T	0.656	0.56
32_Y	46_M	0.652	0.55
56_D	60_V	0.650	0.55
118_N	174_Q	0.650	0.55
144_M	152_I	0.645	0.55
102_E	156_L	0.643	0.54
39_P	52_T	0.641	0.54
130_S	135_N	0.640	0.54
82_V	113_L	0.634	0.53
94_N	130_S	0.630	0.53
75_S	82_V	0.630	0.53
165_V	168_E	0.625	0.52
77_D	171_R	0.622	0.52
34_I	38_L	0.617	0.51
46_M	54_L	0.616	0.51
164_K	167_E	0.614	0.51
127_L	134_K	0.613	0.51
33_V	171_R	0.612	0.51
100_Y	144_M	0.612	0.51
76_L	165_V	0.610	0.50
38_L	43_P	0.608	0.50
146_N	169_I	0.607	0.50
139_N	144_M	0.605	0.50
56_D	59_I	0.602	0.50
30_L	39_P	0.602	0.50
39_P	48_L	0.595	0.49
101_I	156_L	0.593	0.49
147_S	150_V	0.591	0.48
117_I	168_E	0.591	0.48
99_D	165_V	0.586	0.48
34_I	40_L	0.583	0.47
92_N	175_E	0.577	0.47
39_P	44_G	0.568	0.46
121_G	124_V	0.568	0.46
38_L	50_S	0.563	0.45
109_L	171_R	0.563	0.45
157_N	164_K	0.563	0.45
128_E	166_T	0.555	0.44
45_S	52_T	0.555	0.44
115_L	129_V	0.551	0.44
138_I	144_M	0.550	0.44
30_L	34_I	0.546	0.43
95_L	131_S	0.542	0.43
49_G	74_Q	0.542	0.43
116_N	173_I	0.540	0.42
29_D	34_I	0.539	0.42
64_N	67_G	0.538	0.42
36_S	42_P	0.537	0.42
114_N	123_E	0.537	0.42
58_L	63_N	0.535	0.42
129_V	132_E	0.535	0.42
103_L	133_R	0.535	0.42
76_L	95_L	0.534	0.42
57_D	66_T	0.532	0.42
88_R	94_N	0.531	0.41
125_V	174_Q	0.530	0.41
144_M	150_V	0.525	0.41
48_L	56_D	0.525	0.41
145_A	151_L	0.524	0.41
70_S	74_Q	0.520	0.40
101_I	150_V	0.519	0.40
31_S	39_P	0.519	0.40
58_L	110_N	0.518	0.40
150_V	155_K	0.513	0.39
96_G	149_S	0.511	0.39
77_D	164_K	0.511	0.39
28_K	76_L	0.510	0.39
130_S	137_R	0.508	0.39
105_L	166_T	0.506	0.39
91_G	174_Q	0.502	0.38
62_F	84_E	0.502	0.38
28_K	34_I	0.500	0.38

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1q55A	2	0.956	99.7	0.455	Contact Map
1l3wA	1	0.956	99.7	0.471	Contact Map
3q2vA	2	0.956	99.7	0.472	Contact Map
3q2wA	2	0.9615	99.7	0.486	Contact Map
3ubfA	2	0.9341	99.6	0.5	Contact Map
3mvsA	1	0.9121	99.6	0.501	Contact Map
4ux8A	1	0.9121	99.6	0.52	Contact Map
3ubhA	1	0.967	99.6	0.523	Contact Map
2a4eA	2	0.9121	99.6	0.525	Contact Map
2a62A	2	0.9505	99.5	0.537	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.