Q97ZL9 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97ZL9 - Uncharacterized protein

UniProt:	Q97ZL9	Sequences: MFFDLHVHSRYSDGKYLPKDIIAYAKAKHIHVAITDHDTSLGLNTVKEEKVIPGQEVTTEYGHVVILCNFPPSPPNRIAELVDYAKENSCVVFPSHPFDIFRKGIGDKTFRYKFDLIEIYNSKAPKMANNKAKEASIRLNLPGVSNSDAHVIQAIGSAYNDLYEIIEFNLDDILDNLRRGKIRNIINGLSFRAKFSILQWYIERKIRNAQNSSRTMHQV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	219 (185)
Sequences:	2106 (1714)
Seq/√Len:	126.0

ECOLI - PHPDC
HALSA - Q9HR48 Q9HML2
SULSO - Q97ZL9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
85_A	90_C	5.263	1.00
35_T	54_G	5.199	1.00
65_V	95_S	4.564	1.00
86_K	115_D	4.328	1.00
9_S	34_I	3.513	1.00
25_A	30_I	2.967	1.00
9_S	21_I	2.724	1.00
4_D	147_S	2.648	1.00
84_Y	87_E	2.515	1.00
24_Y	27_A	2.495	1.00
86_K	92_V	2.442	1.00
129_N	132_A	2.434	1.00
66_I	85_A	2.398	1.00
167_E	172_D	2.374	1.00
17_L	20_D	2.355	1.00
5_L	33_A	2.266	1.00
7_V	32_V	2.235	1.00
93_F	144_V	2.200	1.00
93_F	116_L	2.178	1.00
57_V	66_I	2.146	1.00
58_T	63_H	2.132	1.00
67_L	93_F	2.079	1.00
79_A	83_D	2.065	1.00
92_V	115_D	2.062	1.00
77_R	80_E	2.011	1.00
7_V	21_I	1.949	1.00
175_D	179_R	1.890	1.00
119_I	143_G	1.879	1.00
68_C	174_L	1.757	1.00
39_T	42_G	1.748	1.00
174_L	178_R	1.719	1.00
65_V	93_F	1.705	1.00
85_A	92_V	1.691	1.00
38_D	58_T	1.629	1.00
116_L	142_P	1.629	1.00
83_D	113_K	1.625	1.00
23_A	27_A	1.574	1.00
19_K	23_A	1.555	1.00
84_Y	88_N	1.544	1.00
114_F	141_L	1.532	1.00
20_D	23_A	1.507	1.00
83_D	87_E	1.479	1.00
25_A	32_V	1.457	1.00
10_R	17_L	1.423	1.00
4_D	7_V	1.421	1.00
98_F	132_A	1.405	1.00
167_E	173_I	1.377	1.00
16_Y	149_A	1.357	1.00
24_Y	28_K	1.355	1.00
108_K	111_R	1.341	1.00
66_I	69_N	1.282	1.00
55_Q	66_I	1.274	1.00
154_A	157_S	1.270	1.00
64_V	85_A	1.240	1.00
107_D	110_F	1.229	0.99
165_I	172_D	1.209	0.99
82_V	113_K	1.203	0.99
145_S	160_N	1.199	0.99
33_A	67_L	1.184	0.99
32_V	51_V	1.171	0.99
142_P	180_G	1.157	0.99
11_Y	41_L	1.154	0.99
9_S	43_L	1.129	0.99
127_M	131_K	1.117	0.99
65_V	146_N	1.107	0.99
82_V	92_V	1.105	0.99
170_L	174_L	1.096	0.99
46_V	50_K	1.090	0.99
4_D	145_S	1.086	0.99
66_I	90_C	1.078	0.99
175_D	178_R	1.074	0.99
13_D	63_H	1.071	0.99
94_P	114_F	1.063	0.98
91_V	174_L	1.062	0.98
16_Y	20_D	1.062	0.98
128_A	131_K	1.061	0.98
137_I	143_G	1.055	0.98
7_V	35_T	1.047	0.98
2_F	159_Y	1.041	0.98
37_H	150_H	1.017	0.98
2_F	161_D	1.016	0.98
169_N	172_D	0.999	0.98
165_I	173_I	0.992	0.98
17_L	21_I	0.978	0.97
160_N	182_I	0.964	0.97
7_V	33_A	0.960	0.97
71_P	88_N	0.951	0.97
109_T	112_Y	0.946	0.97
4_D	30_I	0.943	0.97
19_K	45_T	0.941	0.97
37_H	148_D	0.940	0.97
156_G	159_Y	0.938	0.97
142_P	182_I	0.924	0.96
156_G	160_N	0.918	0.96
14_G	97_P	0.902	0.96
133_K	136_S	0.900	0.96
18_P	22_I	0.887	0.95
44_N	48_E	0.886	0.95
123_K	154_A	0.880	0.95
145_S	158_A	0.879	0.95
131_K	134_E	0.878	0.95
5_L	144_V	0.875	0.95
59_T	62_G	0.873	0.95
80_E	83_D	0.870	0.95
97_P	145_S	0.862	0.95
23_A	26_K	0.861	0.95
33_A	64_V	0.858	0.95
45_T	48_E	0.857	0.94
40_S	69_N	0.849	0.94
165_I	169_N	0.842	0.94
134_E	138_R	0.836	0.94
146_N	160_N	0.834	0.94
149_A	156_G	0.833	0.94
135_A	138_R	0.831	0.94
3_F	173_I	0.830	0.93
135_A	139_L	0.830	0.93
185_I	188_G	0.830	0.93
16_Y	24_Y	0.827	0.93
83_D	86_K	0.823	0.93
15_K	153_Q	0.819	0.93
3_F	162_L	0.800	0.92
60_E	77_R	0.798	0.92
136_S	140_N	0.796	0.92
119_I	133_K	0.795	0.92
68_C	99_D	0.792	0.92
132_A	136_S	0.791	0.92
145_S	186_I	0.788	0.92
162_L	165_I	0.784	0.91
134_E	137_I	0.780	0.91
131_K	135_A	0.774	0.91
168_F	172_D	0.769	0.91
144_V	160_N	0.769	0.91
38_D	59_T	0.767	0.91
37_H	96_H	0.762	0.90
132_A	135_A	0.759	0.90
36_D	39_T	0.758	0.90
129_N	133_K	0.756	0.90
65_V	116_L	0.754	0.90
125_P	128_A	0.749	0.89
159_Y	162_L	0.749	0.89
11_Y	42_G	0.746	0.89
49_E	54_G	0.740	0.89
21_I	34_I	0.740	0.89
7_V	25_A	0.739	0.89
82_V	86_K	0.734	0.88
120_Y	124_A	0.733	0.88
142_P	160_N	0.724	0.88
5_L	67_L	0.724	0.88
145_S	180_G	0.721	0.88
18_P	36_D	0.719	0.87
65_V	144_V	0.718	0.87
106_G	109_T	0.717	0.87
23_A	49_E	0.711	0.87
33_A	170_L	0.708	0.87
66_I	82_V	0.708	0.87
55_Q	69_N	0.706	0.86
61_Y	99_D	0.703	0.86
134_E	139_L	0.703	0.86
129_N	135_A	0.702	0.86
24_Y	149_A	0.700	0.86
133_K	137_I	0.697	0.86
79_A	82_V	0.697	0.86
133_K	143_G	0.696	0.86
102_R	105_I	0.690	0.85
78_I	113_K	0.689	0.85
97_P	117_I	0.687	0.85
149_A	155_I	0.683	0.85
43_L	53_P	0.683	0.85
64_V	92_V	0.681	0.84
93_F	177_L	0.672	0.84
23_A	127_M	0.670	0.84
80_E	87_E	0.668	0.83
62_G	99_D	0.666	0.83
20_D	157_S	0.664	0.83
166_I	172_D	0.660	0.83
16_Y	152_I	0.659	0.83
121_N	129_N	0.658	0.82
11_Y	39_T	0.657	0.82
54_G	149_A	0.654	0.82
22_I	32_V	0.654	0.82
106_G	112_Y	0.653	0.82
131_K	138_R	0.648	0.81
144_V	162_L	0.646	0.81
116_L	177_L	0.646	0.81
33_A	52_I	0.640	0.81
77_R	83_D	0.639	0.81
69_N	90_C	0.637	0.80
162_L	176_N	0.635	0.80
86_K	113_K	0.634	0.80
162_L	167_E	0.630	0.80
76_N	81_L	0.630	0.80
59_T	78_I	0.628	0.79
25_A	147_S	0.627	0.79
9_S	42_G	0.625	0.79
69_N	88_N	0.621	0.79
43_L	85_A	0.621	0.79
100_I	105_I	0.613	0.78
113_K	141_L	0.612	0.78
80_E	175_D	0.612	0.78
86_K	91_V	0.611	0.78
171_D	175_D	0.604	0.77
89_S	113_K	0.602	0.76
107_D	111_R	0.601	0.76
119_I	136_S	0.601	0.76
73_S	76_N	0.600	0.76
106_G	110_F	0.600	0.76
64_V	78_I	0.600	0.76
98_F	135_A	0.599	0.76
166_I	171_D	0.597	0.76
91_V	177_L	0.596	0.76
30_I	147_S	0.595	0.76
22_I	51_V	0.595	0.76
93_F	146_N	0.590	0.75
59_T	64_V	0.589	0.75
98_F	129_N	0.587	0.75
175_D	181_K	0.585	0.74
61_Y	78_I	0.585	0.74
9_S	149_A	0.584	0.74
66_I	81_L	0.582	0.74
47_K	50_K	0.581	0.74
52_I	94_P	0.579	0.74
66_I	88_N	0.577	0.73
48_E	80_E	0.576	0.73
16_Y	21_I	0.575	0.73
7_V	54_G	0.573	0.73
62_G	98_F	0.571	0.73
130_N	133_K	0.571	0.73
66_I	92_V	0.570	0.73
94_P	146_N	0.569	0.72
18_P	99_D	0.568	0.72
4_D	156_G	0.566	0.72
10_R	14_G	0.566	0.72
131_K	136_S	0.564	0.72
69_N	170_L	0.563	0.72
64_V	114_F	0.562	0.72
58_T	95_S	0.561	0.71
145_S	151_V	0.560	0.71
9_S	36_D	0.558	0.71
105_I	108_K	0.557	0.71
121_N	145_S	0.557	0.71
110_F	179_R	0.554	0.70
79_A	112_Y	0.553	0.70
137_I	171_D	0.551	0.70
155_I	162_L	0.550	0.70
53_P	63_H	0.549	0.70
137_I	140_N	0.545	0.69
103_K	107_D	0.545	0.69
96_H	148_D	0.545	0.69
84_Y	137_I	0.541	0.69
122_S	146_N	0.541	0.69
55_Q	63_H	0.539	0.68
8_H	148_D	0.538	0.68
68_C	85_A	0.534	0.68
33_A	173_I	0.533	0.68
101_F	146_N	0.533	0.68
57_V	81_L	0.532	0.67
96_H	150_H	0.532	0.67
130_N	134_E	0.532	0.67
116_L	144_V	0.532	0.67
162_L	173_I	0.532	0.67
26_K	50_K	0.531	0.67
57_V	61_Y	0.529	0.67
23_A	87_E	0.528	0.67
87_E	130_N	0.527	0.67
9_S	54_G	0.522	0.66
9_S	14_G	0.519	0.65
132_A	141_L	0.517	0.65
63_H	96_H	0.516	0.65
34_I	45_T	0.516	0.65
19_K	140_N	0.514	0.65
14_G	17_L	0.509	0.64
12_S	36_D	0.508	0.64
136_S	143_G	0.507	0.64
99_D	123_K	0.507	0.64
34_I	51_V	0.503	0.63
46_V	49_E	0.502	0.63
4_D	25_A	0.500	0.63
124_A	157_S	0.500	0.63

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3o0fA	1	0.8265	100	0.466	Contact Map
3e38A	4	0.9772	100	0.468	Contact Map
2yb1A	1	0.8402	100	0.476	Contact Map
2anuA	5	0.7991	100	0.477	Contact Map
2wjeA	1	0.8584	99.9	0.59	Contact Map
2w9mA	1	0.8311	99.9	0.593	Contact Map
1m65A	3	0.895	99.9	0.596	Contact Map
4gc3A	1	0.8265	99.9	0.607	Contact Map
2hnhA	1	0.9361	99.8	0.622	Contact Map
4gx8A	1	0.9406	99.8	0.622	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0169 seconds.