Q97ZL3 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97ZL3 - Uncharacterized protein

UniProt:	Q97ZL3	Sequences: MASSKVEDFVKNWGGKQEPSIGERIKNAFKPQQPLRYRLVMANYRLRTMVSRLDVYISRLQERDRTLFEKVVESQMSKDTARAAMYANEIAEIRKISRQLITTQIALEQVQLRLETITELGDVFNSLIPVLGVIKELRNAMKGVMPEISLELAELEEGLQEVVIEAGDFTGAPANYGASSPEARKILEEASVVAEQRMKEKFPELPSFVTSTQKVSNQEQK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	221 (200)
Sequences:	116 (89)
Seq/√Len:	6.3

SULSO - Q97ZL3 Q97ZJ6 Q97ZX1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
106_A	195_E	3.641	0.91
68_F	190_A	3.218	0.84
57_I	96_I	2.918	0.78
120_L	155_L	2.643	0.70
113_R	145_M	2.445	0.64
52_R	148_I	2.322	0.60
79_D	194_A	2.311	0.59
86_Y	117_I	2.280	0.58
82_R	183_A	2.172	0.54
182_E	194_A	2.169	0.54
193_V	197_R	2.136	0.53
74_S	79_D	2.120	0.52
56_Y	92_E	2.066	0.50
12_N	209_V	2.030	0.49
17_Q	51_S	1.990	0.48
63_R	100_L	1.974	0.47
83_A	87_A	1.965	0.47
92_E	109_Q	1.922	0.45
184_R	188_E	1.888	0.44
122_D	145_M	1.868	0.43
75_Q	86_Y	1.829	0.42
114_L	190_A	1.823	0.42
67_L	194_A	1.790	0.40
96_I	159_L	1.755	0.39
199_K	206_P	1.738	0.39
92_E	113_R	1.726	0.38
68_F	114_L	1.689	0.37
14_G	23_E	1.674	0.36
120_L	131_L	1.666	0.36
113_R	203_P	1.630	0.35
24_R	135_K	1.625	0.35
16_K	20_S	1.613	0.34
47_R	111_Q	1.583	0.33
60_L	84_A	1.563	0.33
19_P	23_E	1.552	0.32
119_E	162_V	1.537	0.32
12_N	16_K	1.517	0.31
32_Q	52_R	1.511	0.31
151_E	202_F	1.486	0.30
133_V	199_K	1.479	0.30
64_D	94_R	1.477	0.30
89_E	146_P	1.456	0.29
127_L	137_L	1.456	0.29
90_I	125_N	1.454	0.29
107_L	182_E	1.451	0.29
74_S	193_V	1.449	0.29
63_R	138_R	1.449	0.29
123_V	134_I	1.429	0.29
100_L	155_L	1.417	0.28
161_E	165_E	1.410	0.28
27_N	187_L	1.406	0.28
84_A	163_V	1.403	0.28
75_Q	130_V	1.370	0.27
16_K	21_I	1.359	0.27
46_L	107_L	1.347	0.26
38_R	59_R	1.344	0.26
96_I	134_I	1.334	0.26
42_A	59_R	1.321	0.26
80_T	187_L	1.313	0.25
20_S	23_E	1.298	0.25
83_A	134_I	1.292	0.25
157_E	197_R	1.286	0.25
12_N	17_Q	1.286	0.25
110_V	124_F	1.279	0.24
133_V	147_E	1.275	0.24
52_R	187_L	1.267	0.24
120_L	135_K	1.265	0.24
185_K	194_A	1.263	0.24
77_S	137_L	1.260	0.24
35_L	75_Q	1.254	0.24
93_I	152_L	1.236	0.23
131_L	179_S	1.232	0.23
124_F	128_I	1.226	0.23
17_Q	21_I	1.224	0.23
127_L	185_K	1.209	0.23
152_L	196_Q	1.208	0.23
88_N	179_S	1.208	0.23
49_M	103_T	1.207	0.22
177_G	180_S	1.205	0.22
106_A	197_R	1.193	0.22
113_R	122_D	1.188	0.22
130_V	167_G	1.186	0.22
98_R	106_A	1.185	0.22
16_K	24_R	1.153	0.21
64_D	195_E	1.141	0.21
133_V	158_G	1.140	0.21
83_A	86_Y	1.130	0.21
16_K	22_G	1.128	0.21
81_A	162_V	1.128	0.21
88_N	182_E	1.126	0.20
105_I	197_R	1.126	0.20
31_P	150_L	1.124	0.20
32_Q	183_A	1.105	0.20
185_K	198_M	1.104	0.20
132_G	205_L	1.103	0.20
54_D	191_S	1.090	0.20
14_G	22_G	1.085	0.20
98_R	205_L	1.079	0.19
36_R	113_R	1.078	0.19
64_D	98_R	1.076	0.19
55_V	157_E	1.075	0.19
112_L	115_E	1.074	0.19
12_N	26_K	1.066	0.19
43_N	156_E	1.053	0.19
67_L	126_S	1.053	0.19
17_Q	22_G	1.051	0.19
55_V	197_R	1.041	0.19
134_I	148_I	1.040	0.19
146_P	189_E	1.037	0.18
89_E	189_E	1.037	0.18
83_A	199_K	1.028	0.18
53_L	145_M	1.022	0.18
60_L	121_G	1.018	0.18
75_Q	165_E	1.014	0.18
39_L	52_R	1.010	0.18
14_G	17_Q	1.009	0.18
133_V	200_E	1.003	0.18
134_I	155_L	1.001	0.18
52_R	80_T	0.993	0.18
60_L	70_K	0.983	0.17
42_A	99_Q	0.975	0.17
164_I	204_E	0.975	0.17
22_G	28_A	0.971	0.17
159_L	193_V	0.968	0.17
25_I	191_S	0.967	0.17
38_R	153_A	0.963	0.17
121_G	134_I	0.961	0.17
11_K	14_G	0.946	0.17
62_E	98_R	0.945	0.17
186_I	203_P	0.942	0.16
147_E	162_V	0.938	0.16
69_E	198_M	0.932	0.16
110_V	181_P	0.924	0.16
147_E	200_E	0.922	0.16
95_K	112_L	0.922	0.16
37_Y	78_K	0.910	0.16
49_M	99_Q	0.908	0.16
86_Y	143_G	0.906	0.16
116_T	206_P	0.896	0.16
71_V	84_A	0.896	0.16
80_T	98_R	0.896	0.16
147_E	152_L	0.894	0.16
172_A	197_R	0.886	0.15
25_I	207_S	0.886	0.15
67_L	79_D	0.879	0.15
76_M	184_R	0.875	0.15
79_D	129_P	0.869	0.15
127_L	187_L	0.867	0.15
46_L	116_T	0.866	0.15
20_S	46_L	0.863	0.15
86_Y	115_E	0.857	0.15
19_P	25_I	0.857	0.15
166_A	198_M	0.856	0.15
113_R	180_S	0.851	0.15
41_M	90_I	0.841	0.15
24_R	144_V	0.835	0.14
175_N	207_S	0.834	0.14
21_I	30_K	0.833	0.14
152_L	183_A	0.831	0.14
134_I	181_P	0.827	0.14
102_T	148_I	0.825	0.14
76_M	82_R	0.825	0.14
96_I	115_E	0.815	0.14
63_R	152_L	0.812	0.14
103_T	137_L	0.807	0.14
61_Q	145_M	0.805	0.14
87_A	144_V	0.805	0.14
131_L	165_E	0.801	0.14
147_E	167_G	0.793	0.14
53_L	117_I	0.787	0.14
34_P	133_V	0.787	0.14
77_S	145_M	0.787	0.14
49_M	129_P	0.784	0.14
94_R	116_T	0.780	0.13
90_I	140_A	0.778	0.13
36_R	125_N	0.775	0.13
17_Q	24_R	0.774	0.13
27_N	36_R	0.771	0.13
122_D	151_E	0.770	0.13
129_P	203_P	0.769	0.13
87_A	187_L	0.764	0.13
20_S	41_M	0.760	0.13
80_T	87_A	0.758	0.13
129_P	148_I	0.754	0.13
124_F	186_I	0.754	0.13
36_R	180_S	0.750	0.13
120_L	186_I	0.747	0.13
30_K	38_R	0.744	0.13
145_M	160_Q	0.744	0.13
91_A	202_F	0.742	0.13
20_S	24_R	0.733	0.13
64_D	182_E	0.733	0.13
31_P	135_K	0.726	0.13
75_Q	80_T	0.726	0.13
67_L	115_E	0.716	0.12
124_F	159_L	0.711	0.12
101_I	201_K	0.709	0.12
152_L	182_E	0.707	0.12
65_R	143_G	0.704	0.12
23_E	210_T	0.694	0.12
87_A	149_S	0.694	0.12
104_Q	122_D	0.691	0.12
26_K	71_V	0.690	0.12
46_L	160_Q	0.690	0.12
28_A	65_R	0.687	0.12
44_Y	124_F	0.685	0.12
20_S	135_K	0.685	0.12
29_F	131_L	0.683	0.12
30_K	131_L	0.680	0.12
27_N	123_V	0.678	0.12
51_S	144_V	0.677	0.12
182_E	191_S	0.676	0.12
20_S	28_A	0.667	0.12
42_A	95_K	0.667	0.12
110_V	123_V	0.666	0.12
64_D	194_A	0.666	0.12
21_I	25_I	0.665	0.12
88_N	116_T	0.662	0.12
57_I	104_Q	0.659	0.12
25_I	164_I	0.657	0.12
23_E	29_F	0.656	0.12
177_G	210_T	0.652	0.11
79_D	182_E	0.647	0.11
85_M	198_M	0.646	0.11
101_I	202_F	0.644	0.11
12_N	21_I	0.639	0.11
25_I	28_A	0.636	0.11
110_V	117_I	0.632	0.11
18_E	43_N	0.631	0.11
38_R	68_F	0.620	0.11
31_P	145_M	0.615	0.11
20_S	25_I	0.613	0.11
49_M	130_V	0.609	0.11
136_E	182_E	0.600	0.11
46_L	81_A	0.597	0.11
62_E	82_R	0.591	0.11
41_M	125_N	0.591	0.11
123_V	155_L	0.589	0.11
121_G	159_L	0.589	0.11
45_R	74_S	0.589	0.11
115_E	133_V	0.588	0.11
60_L	74_S	0.587	0.11
41_M	138_R	0.587	0.11
83_A	186_I	0.587	0.11
123_V	195_E	0.585	0.10
94_R	112_L	0.584	0.10
33_Q	118_T	0.582	0.10
87_A	146_P	0.580	0.10
12_N	27_N	0.579	0.10
71_V	173_P	0.575	0.10
69_E	199_K	0.575	0.10
176_Y	209_V	0.574	0.10
14_G	20_S	0.574	0.10
96_I	173_P	0.573	0.10
51_S	171_G	0.571	0.10
70_K	203_P	0.569	0.10
44_Y	119_E	0.569	0.10
39_L	94_R	0.567	0.10
77_S	209_V	0.567	0.10
95_K	120_L	0.566	0.10
82_R	180_S	0.566	0.10
55_V	179_S	0.566	0.10
112_L	190_A	0.566	0.10
98_R	198_M	0.564	0.10
43_N	93_I	0.563	0.10
52_R	175_N	0.557	0.10
70_K	74_S	0.554	0.10
77_S	181_P	0.553	0.10
67_L	180_S	0.553	0.10
39_L	116_T	0.552	0.10
127_L	203_P	0.543	0.10
61_Q	171_G	0.542	0.10
56_Y	113_R	0.541	0.10
136_E	150_L	0.540	0.10
199_K	204_E	0.540	0.10
151_E	194_A	0.538	0.10
103_T	136_E	0.538	0.10
100_L	164_I	0.537	0.10
129_P	167_G	0.536	0.10
22_G	208_F	0.534	0.10
50_V	125_N	0.534	0.10
31_P	103_T	0.532	0.10
98_R	194_A	0.530	0.10
68_F	122_D	0.527	0.10
78_K	149_S	0.525	0.10
16_K	19_P	0.525	0.10
39_L	211_S	0.523	0.10
82_R	163_V	0.520	0.10
123_V	204_E	0.520	0.10
119_E	134_I	0.515	0.10
155_L	166_A	0.513	0.10
95_K	131_L	0.511	0.10
55_V	178_A	0.506	0.09
70_K	109_Q	0.505	0.09
50_V	188_E	0.505	0.09
86_Y	205_L	0.505	0.09
56_Y	99_Q	0.505	0.09
129_P	186_I	0.503	0.09
45_R	54_D	0.501	0.09
106_A	110_V	0.500	0.09

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2gd5A	2	0.7104	99.7	0.742	Contact Map
3frtA	1	0.6199	99.7	0.757	Contact Map
4abmA	2	0.3258	58.5	0.946	Contact Map
4uxvA	1	0.8688	34.3	0.953	Contact Map
4nqiA	2	0.6561	9.8	0.964	Contact Map
4ecgA	1	0.3891	9.1	0.964	Contact Map
2ocyA	4	0.552	8.4	0.965	Contact Map
1pehA	1	0.1493	7.9	0.965	Contact Map
3viqB	1	0.3801	7.8	0.965	Contact Map
2kk7A	1	0.2353	7.4	0.965	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0077 seconds.