Q97ZG4 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97ZG4 - Uncharacterized protein

UniProt:	Q97ZG4	Sequences: MDIEELKKRIEKYIKGMDERLKDTSSANNKVVELARLYTEDAKYYLEKGDYITALVDVVYAEGLLDAKEIYENSDPKSNVSKKVFVAGTFDILHPGHIEFLKEASKYGRVYVTVARDSNSERIKGRKPINDEQTRLEIIKSIRYVFDAILGDQEDFLKSVERINPDIIFLGPDQKVDEAKLLEELKKRGLSPQIIRLNERIRKWSHSSTTDIINEIKKRYCNLEQR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	226 (188)
Sequences:	421 (315)
Seq/√Len:	23.0

BACSU - TAGD
HALSA - RIBL
SULSO - Q97ZG4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
183_E	187_K	5.817	1.00
102_K	106_K	4.992	1.00
93_L	142_I	3.381	1.00
64_L	69_E	3.148	1.00
130_N	138_I	2.841	0.99
105_S	146_F	2.813	0.99
119_N	123_I	2.637	0.99
38_Y	41_D	2.626	0.99
70_I	74_S	2.487	0.98
130_N	215_E	2.453	0.98
99_E	102_K	2.336	0.97
86_V	100_F	2.288	0.97
102_K	144_Y	2.236	0.97
90_F	100_F	2.218	0.96
206_H	211_D	2.198	0.96
40_E	43_K	2.137	0.96
85_F	152_D	2.021	0.94
87_A	182_L	2.019	0.94
84_V	104_A	2.016	0.94
89_T	115_A	2.008	0.94
65_L	69_E	2.004	0.94
61_A	65_L	1.914	0.92
161_E	190_L	1.832	0.90
103_E	106_K	1.826	0.90
70_I	73_N	1.803	0.89
44_Y	49_G	1.801	0.89
180_K	186_K	1.773	0.89
104_A	123_I	1.773	0.89
130_N	134_T	1.735	0.87
50_D	55_L	1.690	0.86
85_F	113_T	1.669	0.85
104_A	108_G	1.635	0.84
49_G	53_T	1.619	0.83
157_L	188_R	1.580	0.82
137_E	140_K	1.556	0.81
177_D	193_Q	1.551	0.81
44_Y	48_K	1.499	0.78
70_I	75_D	1.480	0.77
38_Y	45_Y	1.465	0.77
179_A	212_I	1.459	0.76
58_V	62_E	1.455	0.76
130_N	142_I	1.441	0.75
219_R	223_L	1.440	0.75
40_E	44_Y	1.438	0.75
30_K	35_A	1.424	0.75
32_V	35_A	1.418	0.74
120_S	128_P	1.416	0.74
115_A	152_D	1.406	0.74
60_Y	65_L	1.393	0.73
30_K	34_L	1.392	0.73
38_Y	44_Y	1.365	0.71
39_T	42_A	1.355	0.71
41_D	44_Y	1.344	0.70
53_T	67_A	1.338	0.70
186_K	191_S	1.318	0.69
171_G	194_I	1.273	0.66
171_G	175_K	1.264	0.65
117_D	125_G	1.263	0.65
133_Q	150_L	1.257	0.65
63_G	67_A	1.253	0.65
95_P	98_I	1.249	0.64
104_A	110_V	1.240	0.64
94_H	209_T	1.238	0.64
68_K	164_N	1.235	0.63
184_E	188_R	1.232	0.63
170_L	182_L	1.231	0.63
31_V	34_L	1.229	0.63
45_Y	49_G	1.217	0.62
95_P	138_I	1.154	0.58
33_E	37_L	1.153	0.58
71_Y	74_S	1.152	0.58
47_E	53_T	1.149	0.58
93_L	130_N	1.135	0.57
71_Y	75_D	1.119	0.56
56_V	68_K	1.090	0.54
157_L	185_L	1.081	0.53
77_K	214_N	1.074	0.53
42_A	45_Y	1.072	0.52
33_E	36_R	1.071	0.52
116_R	152_D	1.069	0.52
212_I	215_E	1.067	0.52
42_A	46_L	1.065	0.52
142_I	170_L	1.065	0.52
89_T	120_S	1.061	0.52
196_R	206_H	1.060	0.52
36_R	58_V	1.056	0.51
157_L	187_K	1.054	0.51
53_T	57_D	1.011	0.48
61_A	66_D	0.999	0.47
115_A	127_K	0.992	0.47
94_H	112_V	0.978	0.46
47_E	50_D	0.961	0.45
33_E	49_G	0.949	0.44
210_T	220_Y	0.941	0.43
37_L	40_E	0.939	0.43
107_Y	192_P	0.937	0.43
37_L	58_V	0.930	0.43
180_K	191_S	0.929	0.43
57_D	65_L	0.926	0.42
61_A	67_A	0.921	0.42
104_A	112_V	0.921	0.42
34_L	51_Y	0.920	0.42
34_L	38_Y	0.920	0.42
193_Q	211_D	0.918	0.42
109_R	164_N	0.908	0.41
134_T	138_I	0.895	0.40
115_A	132_E	0.893	0.40
112_V	134_T	0.893	0.40
59_V	65_L	0.889	0.40
42_A	61_A	0.887	0.40
39_T	46_L	0.880	0.39
84_V	108_G	0.880	0.39
83_K	132_E	0.878	0.39
53_T	60_Y	0.870	0.39
172_P	195_I	0.869	0.39
77_K	127_K	0.867	0.38
54_A	57_D	0.859	0.38
34_L	41_D	0.856	0.38
87_A	146_F	0.853	0.37
84_V	118_S	0.851	0.37
89_T	181_L	0.834	0.36
92_I	142_I	0.832	0.36
45_Y	53_T	0.831	0.36
154_E	165_P	0.829	0.36
207_S	223_L	0.820	0.35
131_D	152_D	0.818	0.35
59_V	69_E	0.817	0.35
46_L	50_D	0.812	0.35
36_R	40_E	0.812	0.35
33_E	39_T	0.812	0.35
55_L	66_D	0.811	0.35
121_E	128_P	0.807	0.35
166_D	223_L	0.807	0.35
217_K	222_N	0.806	0.34
112_V	136_L	0.806	0.34
112_V	139_I	0.804	0.34
93_L	138_I	0.803	0.34
56_V	59_V	0.797	0.34
161_E	176_V	0.796	0.34
145_V	209_T	0.793	0.34
141_S	208_S	0.792	0.34
106_K	143_R	0.787	0.33
136_L	150_L	0.785	0.33
128_P	137_E	0.784	0.33
57_D	68_K	0.782	0.33
32_V	38_Y	0.780	0.33
103_E	114_V	0.779	0.33
88_G	91_D	0.776	0.33
153_Q	182_L	0.774	0.32
109_R	134_T	0.770	0.32
105_S	174_Q	0.769	0.32
139_I	150_L	0.760	0.32
109_R	117_D	0.755	0.31
32_V	67_A	0.755	0.31
64_L	68_K	0.755	0.31
140_K	150_L	0.750	0.31
124_K	166_D	0.744	0.31
72_E	75_D	0.737	0.30
153_Q	159_S	0.736	0.30
153_Q	168_I	0.735	0.30
157_L	184_E	0.731	0.30
41_D	53_T	0.728	0.30
58_V	63_G	0.727	0.30
58_V	66_D	0.724	0.30
149_I	172_P	0.723	0.29
99_E	213_I	0.719	0.29
66_D	133_Q	0.717	0.29
109_R	161_E	0.713	0.29
48_K	54_A	0.710	0.29
50_D	63_G	0.709	0.29
87_A	113_T	0.706	0.28
149_I	163_I	0.704	0.28
220_Y	224_E	0.704	0.28
60_Y	68_K	0.696	0.28
90_F	127_K	0.694	0.28
40_E	47_E	0.690	0.28
221_C	225_Q	0.688	0.27
158_K	162_R	0.687	0.27
102_K	213_I	0.687	0.27
184_E	187_K	0.686	0.27
51_Y	54_A	0.686	0.27
115_A	120_S	0.685	0.27
87_A	170_L	0.685	0.27
48_K	53_T	0.680	0.27
89_T	98_I	0.679	0.27
141_S	163_I	0.678	0.27
69_E	162_R	0.678	0.27
104_A	217_K	0.676	0.27
36_R	39_T	0.675	0.27
222_N	225_Q	0.673	0.27
61_A	69_E	0.668	0.26
58_V	61_A	0.667	0.26
34_L	40_E	0.666	0.26
42_A	54_A	0.665	0.26
90_F	187_K	0.661	0.26
93_L	139_I	0.659	0.26
47_E	52_I	0.652	0.26
111_Y	165_P	0.648	0.25
64_L	67_A	0.645	0.25
48_K	51_Y	0.643	0.25
63_G	66_D	0.637	0.25
157_L	161_E	0.633	0.25
55_L	69_E	0.633	0.25
32_V	39_T	0.631	0.24
138_I	142_I	0.630	0.24
47_E	51_Y	0.628	0.24
57_D	64_L	0.627	0.24
105_S	143_R	0.625	0.24
134_T	215_E	0.624	0.24
123_I	217_K	0.622	0.24
62_E	66_D	0.619	0.24
113_T	159_S	0.617	0.24
55_L	62_E	0.616	0.24
55_L	161_E	0.615	0.24
82_K	108_G	0.614	0.24
165_P	219_R	0.610	0.23
132_E	136_L	0.610	0.23
32_V	36_R	0.608	0.23
93_L	101_L	0.606	0.23
50_D	54_A	0.603	0.23
30_K	40_E	0.601	0.23
138_I	151_G	0.601	0.23
119_N	188_R	0.599	0.23
100_F	224_E	0.597	0.23
36_R	43_K	0.594	0.23
40_E	59_V	0.593	0.23
173_D	176_V	0.592	0.22
45_Y	55_L	0.592	0.22
178_E	212_I	0.591	0.22
108_G	219_R	0.590	0.22
50_D	65_L	0.587	0.22
56_V	61_A	0.584	0.22
33_E	69_E	0.584	0.22
60_Y	131_D	0.584	0.22
56_V	60_Y	0.580	0.22
169_F	175_K	0.579	0.22
127_K	218_K	0.572	0.22
132_E	138_I	0.572	0.22
34_L	39_T	0.570	0.21
129_I	211_D	0.570	0.21
52_I	58_V	0.566	0.21
91_D	113_T	0.564	0.21
47_E	57_D	0.563	0.21
38_Y	84_V	0.561	0.21
35_A	42_A	0.561	0.21
45_Y	54_A	0.560	0.21
88_G	94_H	0.559	0.21
175_K	197_L	0.559	0.21
83_K	196_R	0.558	0.21
40_E	49_G	0.557	0.21
159_S	175_K	0.557	0.21
57_D	67_A	0.556	0.21
103_E	197_L	0.555	0.21
48_K	52_I	0.547	0.20
100_F	194_I	0.547	0.20
128_P	141_S	0.545	0.20
37_L	50_D	0.544	0.20
90_F	214_N	0.539	0.20
60_Y	143_R	0.538	0.20
117_D	135_R	0.533	0.20
81_S	148_A	0.533	0.20
88_G	96_G	0.532	0.20
196_R	208_S	0.532	0.20
80_V	166_D	0.530	0.20
38_Y	62_E	0.530	0.20
95_P	144_Y	0.528	0.20
67_A	71_Y	0.526	0.19
186_K	223_L	0.526	0.19
127_K	181_L	0.522	0.19
187_K	190_L	0.519	0.19
43_K	46_L	0.518	0.19
41_D	49_G	0.517	0.19
65_L	158_K	0.516	0.19
169_F	219_R	0.516	0.19
60_Y	69_E	0.515	0.19
112_V	143_R	0.510	0.19
110_V	206_H	0.509	0.19
58_V	64_L	0.508	0.19
214_N	218_K	0.504	0.19
147_D	169_F	0.503	0.18
103_E	163_I	0.501	0.18
214_N	219_R	0.500	0.18

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3elbA	2	0.8009	100	0.526	Contact Map
4mvcA	2	0.7611	100	0.618	Contact Map
3hl4A	2	0.7434	99.9	0.647	Contact Map
3glvA	2	0.5354	99.8	0.717	Contact Map
2b7lA	2	0.5	99.8	0.73	Contact Map
1cozA	2	0.5487	99.8	0.735	Contact Map
3do8A	2	0.5487	99.6	0.78	Contact Map
1mrzA	2	0.6062	99.4	0.804	Contact Map
3op1A	4	0.6991	99.3	0.808	Contact Map
2x0kA	5	0.6903	99.2	0.818	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0077 seconds.