RIFK - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RIFK - Riboflavin kinase

UniProt:	Q97ZG3	Sequences: MEDDKLIVRIISKEGEIIRLTEEGERFLSSCLSSLKDAILSLHSIEIKGNIVSGLGEGKIFLSMEYYKSQINKIMGFDPFPGTLNIVIYDKASLENRLLLDSSPSLMVPEYKQKDRVLGAVKLYPAAINKLTPAAVVIPLRTTHPKSVIEIISPFHLREKLNLKDGDEVTIEVYV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	175 (170)
Sequences:	167 (129)
Seq/√Len:	9.9

HALSA - RIFK
SULSO - RIFK

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
35_L	39_I	3.275	0.95
47_I	88_I	3.228	0.95
120_A	140_L	2.859	0.91
72_N	78_D	2.830	0.90
60_I	111_Y	2.809	0.90
105_S	124_Y	2.803	0.90
77_F	135_A	2.663	0.87
16_E	31_C	2.537	0.84
70_Q	74_I	2.319	0.78
31_C	35_L	2.160	0.73
66_Y	143_T	2.126	0.72
15_G	93_S	2.116	0.71
164_K	167_D	2.110	0.71
74_I	109_P	2.088	0.70
18_I	41_S	1.980	0.66
45_I	140_L	1.867	0.61
60_I	144_H	1.849	0.60
53_S	59_K	1.837	0.60
156_H	159_E	1.834	0.60
123_L	148_V	1.818	0.59
16_E	71_I	1.815	0.59
158_R	165_D	1.726	0.55
29_S	38_A	1.703	0.54
47_I	62_L	1.703	0.54
124_Y	153_S	1.694	0.53
36_K	86_I	1.686	0.53
71_I	123_L	1.677	0.53
113_Q	124_Y	1.661	0.52
137_V	145_P	1.642	0.51
118_L	139_P	1.638	0.51
31_C	118_L	1.635	0.51
118_L	151_I	1.606	0.49
105_S	122_K	1.572	0.48
136_V	163_L	1.567	0.48
5_K	18_I	1.566	0.48
59_K	121_V	1.558	0.47
47_I	121_V	1.556	0.47
68_K	78_D	1.493	0.44
88_I	143_T	1.487	0.44
105_S	126_A	1.485	0.44
134_A	154_P	1.481	0.44
31_C	144_H	1.452	0.42
116_R	141_R	1.441	0.42
20_L	115_D	1.413	0.41
86_I	142_T	1.370	0.39
100_L	173_V	1.342	0.38
110_E	151_I	1.341	0.38
125_P	134_A	1.336	0.37
8_V	169_V	1.334	0.37
16_E	38_A	1.333	0.37
12_S	47_I	1.331	0.37
118_L	144_H	1.325	0.37
3_D	169_V	1.323	0.37
51_I	163_L	1.315	0.36
70_Q	123_L	1.299	0.36
157_L	161_L	1.265	0.34
88_I	123_L	1.260	0.34
80_F	164_K	1.250	0.34
110_E	134_A	1.242	0.33
16_E	70_Q	1.236	0.33
69_S	89_Y	1.235	0.33
55_L	145_P	1.231	0.33
87_V	144_H	1.226	0.33
88_I	97_R	1.221	0.33
38_A	151_I	1.212	0.32
16_E	32_L	1.203	0.32
28_L	139_P	1.203	0.32
12_S	17_I	1.202	0.32
100_L	118_L	1.189	0.31
16_E	35_L	1.177	0.31
77_F	137_V	1.176	0.31
75_M	165_D	1.168	0.30
106_L	152_I	1.147	0.30
39_I	143_T	1.141	0.29
4_D	55_L	1.138	0.29
87_V	134_A	1.133	0.29
35_L	121_V	1.127	0.29
77_F	145_P	1.120	0.29
31_C	38_A	1.117	0.29
106_L	153_S	1.115	0.28
62_L	140_L	1.114	0.28
64_M	69_S	1.111	0.28
109_P	137_V	1.107	0.28
60_I	118_L	1.097	0.28
52_V	144_H	1.090	0.28
3_D	6_L	1.080	0.27
159_E	171_I	1.076	0.27
14_E	25_E	1.051	0.26
159_E	164_K	1.047	0.26
21_T	32_L	1.034	0.26
11_I	122_K	1.014	0.25
31_C	139_P	1.006	0.25
1_M	15_G	1.003	0.24
157_L	165_D	1.001	0.24
44_S	171_I	0.996	0.24
20_L	30_S	0.994	0.24
123_L	137_V	0.988	0.24
120_A	139_P	0.975	0.24
120_A	132_T	0.968	0.23
52_V	87_V	0.964	0.23
158_R	163_L	0.958	0.23
2_E	24_G	0.944	0.23
20_L	24_G	0.940	0.22
23_E	169_V	0.929	0.22
9_R	16_E	0.921	0.22
134_A	151_I	0.918	0.22
5_K	108_V	0.899	0.21
61_F	111_Y	0.893	0.21
27_F	129_N	0.893	0.21
110_E	118_L	0.890	0.21
167_D	171_I	0.889	0.21
89_Y	149_I	0.889	0.21
142_T	173_V	0.887	0.21
151_I	163_L	0.884	0.21
150_E	158_R	0.876	0.20
26_R	37_D	0.873	0.20
162_N	167_D	0.866	0.20
55_L	77_F	0.866	0.20
61_F	118_L	0.852	0.20
86_I	172_E	0.848	0.20
86_I	151_I	0.841	0.19
89_Y	143_T	0.841	0.19
110_E	120_A	0.827	0.19
18_I	142_T	0.826	0.19
14_E	35_L	0.825	0.19
88_I	118_L	0.824	0.19
122_K	138_I	0.823	0.19
14_E	39_I	0.819	0.19
57_E	79_P	0.818	0.19
66_Y	113_Q	0.804	0.18
44_S	103_S	0.800	0.18
16_E	139_P	0.799	0.18
31_C	39_I	0.795	0.18
52_V	148_V	0.786	0.18
3_D	138_I	0.778	0.18
68_K	72_N	0.777	0.18
61_F	117_V	0.770	0.17
118_L	145_P	0.765	0.17
14_E	80_F	0.765	0.17
62_L	86_I	0.761	0.17
9_R	88_I	0.760	0.17
16_E	147_S	0.756	0.17
122_K	159_E	0.755	0.17
51_I	123_L	0.749	0.17
31_C	70_Q	0.748	0.17
88_I	121_V	0.736	0.17
105_S	118_L	0.729	0.16
2_E	13_K	0.725	0.16
30_S	34_S	0.723	0.16
31_C	59_K	0.722	0.16
137_V	163_L	0.721	0.16
46_E	72_N	0.720	0.16
106_L	171_I	0.716	0.16
117_V	141_R	0.707	0.16
64_M	153_S	0.706	0.16
135_A	145_P	0.703	0.16
121_V	148_V	0.700	0.16
106_L	123_L	0.696	0.16
61_F	110_E	0.696	0.16
77_F	123_L	0.694	0.16
86_I	162_N	0.694	0.16
67_Y	119_G	0.689	0.15
35_L	70_Q	0.676	0.15
45_I	120_A	0.674	0.15
113_Q	123_L	0.673	0.15
23_E	171_I	0.671	0.15
139_P	161_L	0.670	0.15
125_P	128_I	0.669	0.15
150_E	157_L	0.664	0.15
25_E	125_P	0.659	0.15
6_L	32_L	0.657	0.15
46_E	80_F	0.655	0.15
18_I	53_S	0.654	0.15
20_L	23_E	0.654	0.15
11_I	45_I	0.652	0.15
71_I	113_Q	0.651	0.15
80_F	163_L	0.649	0.15
80_F	112_K	0.648	0.15
90_D	147_S	0.647	0.14
64_M	97_R	0.644	0.14
45_I	149_I	0.643	0.14
80_F	156_H	0.642	0.14
3_D	103_S	0.642	0.14
154_P	161_L	0.638	0.14
62_L	137_V	0.637	0.14
16_E	118_L	0.635	0.14
126_A	140_L	0.631	0.14
47_I	129_N	0.631	0.14
110_E	115_D	0.624	0.14
61_F	143_T	0.622	0.14
63_S	76_G	0.621	0.14
22_E	26_R	0.611	0.14
70_Q	117_V	0.611	0.14
23_E	164_K	0.610	0.14
122_K	160_K	0.610	0.14
66_Y	70_Q	0.609	0.14
2_E	7_I	0.606	0.14
31_C	34_S	0.606	0.14
105_S	125_P	0.601	0.13
3_D	8_V	0.601	0.13
37_D	153_S	0.601	0.13
51_I	115_D	0.600	0.13
100_L	171_I	0.600	0.13
74_I	135_A	0.600	0.13
58_G	67_Y	0.597	0.13
77_F	109_P	0.596	0.13
20_L	68_K	0.596	0.13
75_M	108_V	0.593	0.13
13_K	167_D	0.592	0.13
14_E	53_S	0.592	0.13
55_L	135_A	0.592	0.13
9_R	71_I	0.590	0.13
154_P	173_V	0.578	0.13
6_L	147_S	0.575	0.13
59_K	155_F	0.575	0.13
149_I	167_D	0.571	0.13
59_K	139_P	0.568	0.13
15_G	139_P	0.566	0.13
80_F	114_K	0.564	0.13
68_K	120_A	0.561	0.13
10_I	55_L	0.561	0.13
33_S	99_L	0.561	0.13
60_I	70_Q	0.560	0.13
2_E	9_R	0.558	0.13
119_G	141_R	0.557	0.13
56_G	152_I	0.557	0.13
22_E	151_I	0.554	0.13
13_K	146_K	0.553	0.12
144_H	147_S	0.553	0.12
84_L	163_L	0.552	0.12
124_Y	149_I	0.548	0.12
64_M	117_V	0.546	0.12
18_I	26_R	0.544	0.12
3_D	148_V	0.543	0.12
31_C	61_F	0.543	0.12
100_L	129_N	0.543	0.12
46_E	170_T	0.542	0.12
35_L	143_T	0.542	0.12
29_S	35_L	0.537	0.12
4_D	19_R	0.536	0.12
72_N	128_I	0.533	0.12
77_F	136_V	0.529	0.12
58_G	141_R	0.526	0.12
64_M	88_I	0.526	0.12
2_E	90_D	0.524	0.12
5_K	51_I	0.520	0.12
19_R	43_H	0.515	0.12
22_E	34_S	0.513	0.12
28_L	39_I	0.512	0.12
6_L	46_E	0.510	0.12
103_S	114_K	0.509	0.12
74_I	106_L	0.508	0.12
1_M	9_R	0.507	0.12
28_L	165_D	0.501	0.11
131_L	171_I	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2oynA	2	0.7371	100	0.351	Contact Map
3ctaA	2	0.8171	99.8	0.732	Contact Map
2p8tA	1	0.6571	99.3	0.818	Contact Map
2dqlA	2	0.2514	95.4	0.916	Contact Map
4l9nA	2	0.3829	93.9	0.923	Contact Map
2obpA	1	0.1829	93.6	0.924	Contact Map
3f8bA	2	0.2743	93.1	0.925	Contact Map
2qvoA	2	0.2171	93.1	0.925	Contact Map
2zfwA	2	0.2343	93	0.925	Contact Map
1xmaA	2	0.2686	93	0.926	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.