IF5A - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

IF5A - Translation initiation factor 5A

UniProt:	Q97ZE8	Sequences: MSITYTTVGELKVGSYVVIDGEPCRVVEVTKAKTGKHGSAKANVVAIGVFSGAKKTLMAPVDQQVEVPIIEKHIGQIIADMGNKIQVMDLESYETFEIEKPTEDELASKIKPNAELEYWEIMGRRKIVRVK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	131 (127)
Sequences:	487 (253)
Seq/√Len:	22.4

HALSA - IF5A
SULSO - IF5A

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
18_V	122_M	5.220	1.00
19_I	46_A	4.420	1.00
11_L	26_V	4.167	1.00
42_A	61_V	3.402	1.00
104_D	107_A	2.982	1.00
85_I	127_I	2.977	0.99
39_S	63_Q	2.904	0.99
22_E	124_R	2.646	0.99
27_V	47_I	2.580	0.99
11_L	17_V	2.550	0.98
43_N	58_M	2.430	0.98
9_G	62_D	2.383	0.97
17_V	65_V	2.093	0.95
75_G	87_V	1.839	0.90
118_Y	127_I	1.805	0.89
8_V	29_V	1.786	0.88
9_G	29_V	1.772	0.88
101_P	106_L	1.753	0.87
36_K	41_K	1.686	0.85
37_H	41_K	1.668	0.85
8_V	26_V	1.657	0.84
6_T	10_E	1.655	0.84
48_G	51_S	1.641	0.84
6_T	67_V	1.620	0.83
119_W	128_V	1.487	0.77
83_N	111_K	1.423	0.74
37_H	40_A	1.405	0.73
8_V	17_V	1.368	0.71
8_V	11_L	1.365	0.70
70_I	123_G	1.325	0.68
48_G	55_K	1.319	0.68
87_V	116_L	1.306	0.67
8_V	61_V	1.301	0.67
107_A	110_I	1.275	0.65
36_K	40_A	1.275	0.65
25_R	31_K	1.264	0.64
33_K	59_A	1.254	0.64
105_E	108_S	1.213	0.61
28_E	45_V	1.161	0.58
9_G	61_V	1.134	0.56
51_S	55_K	1.109	0.54
16_Y	122_M	1.097	0.53
29_V	42_A	1.083	0.52
26_V	29_V	1.067	0.51
76_Q	90_L	1.062	0.51
46_A	55_K	1.060	0.51
79_A	86_Q	1.049	0.50
116_L	127_I	1.027	0.48
43_N	51_S	1.020	0.48
4_T	69_I	1.012	0.47
111_K	127_I	0.995	0.46
42_A	126_K	0.970	0.45
99_E	113_N	0.969	0.44
76_Q	119_W	0.965	0.44
86_Q	96_F	0.949	0.43
89_D	93_Y	0.946	0.43
34_T	43_N	0.943	0.43
17_V	42_A	0.940	0.42
46_A	65_V	0.938	0.42
13_V	25_R	0.937	0.42
39_S	57_L	0.933	0.42
47_I	122_M	0.932	0.42
33_K	40_A	0.922	0.41
33_K	60_P	0.912	0.41
61_V	126_K	0.910	0.40
87_V	121_I	0.907	0.40
19_I	130_V	0.903	0.40
15_S	67_V	0.903	0.40
73_H	78_I	0.897	0.40
107_A	111_K	0.896	0.40
78_I	94_E	0.886	0.39
28_E	83_N	0.883	0.39
86_Q	93_Y	0.883	0.39
76_Q	88_M	0.883	0.39
98_I	127_I	0.876	0.38
83_N	107_A	0.865	0.38
77_I	80_D	0.865	0.38
85_I	100_K	0.864	0.37
88_M	119_W	0.863	0.37
10_E	17_V	0.853	0.37
86_Q	95_T	0.851	0.37
119_W	129_R	0.841	0.36
21_G	52_G	0.838	0.36
39_S	64_Q	0.836	0.36
35_G	41_K	0.836	0.36
11_L	29_V	0.830	0.35
121_I	125_R	0.823	0.35
7_T	64_Q	0.819	0.35
38_G	41_K	0.799	0.33
29_V	44_V	0.799	0.33
45_V	122_M	0.798	0.33
18_V	127_I	0.794	0.33
7_T	28_E	0.793	0.33
15_S	101_P	0.790	0.33
72_K	119_W	0.785	0.33
15_S	92_S	0.782	0.32
73_H	89_D	0.780	0.32
79_A	90_L	0.777	0.32
11_L	107_A	0.770	0.32
73_H	85_I	0.757	0.31
76_Q	79_A	0.755	0.31
21_G	66_E	0.754	0.31
79_A	126_K	0.746	0.30
23_P	45_V	0.743	0.30
39_S	62_D	0.742	0.30
50_F	56_T	0.739	0.30
24_C	45_V	0.734	0.30
116_L	122_M	0.733	0.30
54_K	65_V	0.731	0.29
47_I	54_K	0.729	0.29
77_I	129_R	0.728	0.29
84_K	97_E	0.723	0.29
8_V	65_V	0.722	0.29
32_A	35_G	0.719	0.29
77_I	85_I	0.715	0.28
27_V	34_T	0.711	0.28
6_T	15_S	0.707	0.28
8_V	42_A	0.707	0.28
12_K	29_V	0.700	0.28
70_I	94_E	0.686	0.27
34_T	59_A	0.682	0.27
73_H	88_M	0.678	0.26
9_G	15_S	0.673	0.26
36_K	39_S	0.672	0.26
73_H	79_A	0.666	0.26
47_I	98_I	0.662	0.26
9_G	12_K	0.661	0.26
14_G	129_R	0.659	0.25
101_P	111_K	0.653	0.25
55_K	73_H	0.652	0.25
74_I	117_E	0.648	0.25
5_Y	13_V	0.647	0.25
17_V	98_I	0.647	0.25
44_V	61_V	0.642	0.25
39_S	59_A	0.638	0.24
54_K	95_T	0.631	0.24
9_G	33_K	0.630	0.24
19_I	98_I	0.630	0.24
40_A	60_P	0.629	0.24
75_G	96_F	0.626	0.24
26_V	66_E	0.618	0.23
57_L	63_Q	0.617	0.23
109_K	122_M	0.613	0.23
27_V	31_K	0.613	0.23
44_V	65_V	0.612	0.23
17_V	114_A	0.610	0.23
31_K	64_Q	0.603	0.23
98_I	109_K	0.601	0.23
83_N	100_K	0.597	0.22
29_V	62_D	0.594	0.22
16_Y	115_E	0.589	0.22
46_A	95_T	0.586	0.22
30_T	110_I	0.585	0.22
21_G	60_P	0.585	0.22
87_V	96_F	0.584	0.22
14_G	117_E	0.583	0.22
80_D	100_K	0.582	0.22
78_I	88_M	0.580	0.22
67_V	123_G	0.580	0.22
102_T	107_A	0.575	0.21
5_Y	45_V	0.573	0.21
79_A	111_K	0.571	0.21
77_I	116_L	0.568	0.21
60_P	63_Q	0.562	0.21
92_S	110_I	0.562	0.21
5_Y	64_Q	0.557	0.21
31_K	63_Q	0.555	0.20
85_I	110_I	0.551	0.20
22_E	48_G	0.546	0.20
8_V	44_V	0.545	0.20
33_K	54_K	0.543	0.20
91_E	115_E	0.541	0.20
78_I	96_F	0.538	0.20
3_I	18_V	0.530	0.19
78_I	86_Q	0.527	0.19
117_E	129_R	0.526	0.19
117_E	121_I	0.525	0.19
5_Y	9_G	0.524	0.19
27_V	45_V	0.522	0.19
14_G	27_V	0.519	0.19
91_E	107_A	0.518	0.19
86_Q	94_E	0.516	0.19
29_V	102_T	0.512	0.19
45_V	119_W	0.510	0.18
44_V	126_K	0.508	0.18
46_A	49_V	0.506	0.18
95_T	112_P	0.505	0.18
101_P	107_A	0.503	0.18
73_H	91_E	0.500	0.18
47_I	52_G	0.500	0.18

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1khiA	1	0.9466	100	0.318	Contact Map
1bkbA	3	1	100	0.378	Contact Map
1x6oA	1	0.9618	100	0.378	Contact Map
3er0A	1	0.9924	100	0.386	Contact Map
3hksA	1	1	100	0.399	Contact Map
3cpfA	1	0.9618	100	0.399	Contact Map
1iz6A	1	0.9924	100	0.404	Contact Map
2eifA	1	0.9771	100	0.406	Contact Map
1ybyA	2	0.9389	99.9	0.539	Contact Map
3a5zB	1	0.9466	99.9	0.542	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.