Q97ZC7 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97ZC7 - Uncharacterized protein

UniProt:	Q97ZC7	Sequences: MFNVKECKLGFNECVKTLIERIKSSGAEVFAIIDHSENARKVGLSLEPTIVIYFGNPSVGTLLMLHNRHVAYELPLRFLVWSENNVVKIGYRKPSEVGEEYDIRNKELLDKMDKFVEGLLSNL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	123 (115)
Sequences:	495 (414)
Seq/√Len:	38.6

SULSO - Q97ZC7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
10_G	13_E	4.043	1.00
47_E	68_R	2.900	1.00
16_K	32_I	2.754	1.00
49_T	68_R	2.651	1.00
81_W	90_G	2.637	1.00
32_I	50_I	2.545	1.00
73_E	101_Y	2.523	1.00
6_E	86_V	2.521	1.00
19_I	32_I	2.362	1.00
7_C	14_C	2.229	0.99
9_L	17_T	2.229	0.99
44_L	61_T	2.224	0.99
33_I	53_Y	2.181	0.99
66_H	106_K	2.166	0.99
15_V	80_V	2.156	0.99
83_E	88_K	1.912	0.98
77_R	92_R	1.909	0.98
92_R	100_E	1.860	0.98
92_R	96_E	1.625	0.95
67_N	101_Y	1.608	0.95
69_H	101_Y	1.590	0.95
55_G	60_G	1.562	0.94
96_E	100_E	1.562	0.94
12_N	50_I	1.547	0.94
19_I	23_K	1.515	0.93
37_E	41_K	1.498	0.93
59_V	111_K	1.487	0.93
5_K	117_E	1.467	0.92
18_L	119_L	1.423	0.91
46_L	68_R	1.409	0.90
22_I	108_L	1.382	0.89
29_V	52_I	1.378	0.89
15_V	32_I	1.353	0.88
34_D	37_E	1.353	0.88
22_I	27_A	1.336	0.88
60_G	64_M	1.336	0.88
46_L	65_L	1.314	0.87
73_E	100_E	1.227	0.83
44_L	65_L	1.225	0.83
63_L	70_V	1.225	0.83
49_T	71_A	1.216	0.82
63_L	74_L	1.197	0.81
96_E	101_Y	1.197	0.81
12_N	90_G	1.196	0.81
27_A	59_V	1.153	0.79
93_K	113_D	1.146	0.78
48_P	82_S	1.127	0.77
76_L	112_M	1.116	0.77
9_L	14_C	1.109	0.76
92_R	101_Y	1.107	0.76
72_Y	77_R	1.100	0.75
71_A	79_L	1.079	0.74
11_F	50_I	1.056	0.72
39_A	46_L	1.043	0.71
18_L	78_F	1.004	0.69
61_T	65_L	1.002	0.68
35_H	38_N	1.001	0.68
82_S	85_N	0.989	0.67
5_K	91_Y	0.986	0.67
111_K	114_K	0.986	0.67
13_E	17_T	0.975	0.66
73_E	92_R	0.946	0.64
77_R	100_E	0.944	0.64
25_S	118_G	0.934	0.63
11_F	87_V	0.924	0.62
47_E	81_W	0.898	0.60
24_S	40_R	0.887	0.59
114_K	118_G	0.879	0.58
15_V	50_I	0.878	0.58
10_G	80_V	0.871	0.57
54_F	94_P	0.857	0.56
62_L	76_L	0.856	0.56
35_H	51_V	0.854	0.56
16_K	20_E	0.853	0.56
59_V	71_A	0.852	0.56
12_N	16_K	0.831	0.54
35_H	74_L	0.828	0.54
51_V	71_A	0.818	0.53
70_V	94_P	0.817	0.53
11_F	48_P	0.816	0.53
59_V	62_L	0.812	0.52
59_V	72_Y	0.806	0.52
20_E	45_S	0.800	0.51
9_L	102_D	0.798	0.51
22_I	29_V	0.795	0.51
40_R	45_S	0.794	0.51
20_E	23_K	0.794	0.51
57_P	60_G	0.783	0.50
46_L	71_A	0.775	0.49
94_P	112_M	0.773	0.49
61_T	74_L	0.765	0.48
6_E	88_K	0.752	0.47
55_G	64_M	0.745	0.46
14_C	87_V	0.740	0.46
107_E	110_D	0.739	0.46
30_F	34_D	0.738	0.46
7_C	17_T	0.732	0.45
73_E	96_E	0.721	0.44
47_E	71_A	0.719	0.44
102_D	114_K	0.719	0.44
46_L	49_T	0.710	0.43
82_S	87_V	0.710	0.43
99_E	102_D	0.697	0.42
51_V	79_L	0.689	0.41
18_L	48_P	0.686	0.41
79_L	100_E	0.685	0.41
27_A	112_M	0.683	0.41
39_A	74_L	0.682	0.41
76_L	80_V	0.678	0.40
61_T	64_M	0.670	0.40
71_A	96_E	0.666	0.39
15_V	112_M	0.666	0.39
43_G	81_W	0.658	0.39
52_I	80_V	0.658	0.39
56_N	60_G	0.656	0.38
20_E	24_S	0.651	0.38
11_F	17_T	0.643	0.37
34_D	108_L	0.632	0.36
78_F	91_Y	0.627	0.36
11_F	88_K	0.614	0.35
17_T	40_R	0.614	0.35
40_R	84_N	0.612	0.35
59_V	112_M	0.611	0.35
49_T	79_L	0.609	0.34
40_R	87_V	0.604	0.34
98_G	101_Y	0.604	0.34
20_E	43_G	0.602	0.34
63_L	108_L	0.602	0.34
55_G	61_T	0.600	0.34
37_E	99_E	0.599	0.34
15_V	19_I	0.599	0.34
82_S	89_I	0.591	0.33
13_E	16_K	0.590	0.33
30_F	51_V	0.580	0.32
15_V	26_G	0.578	0.32
44_L	64_M	0.575	0.32
57_P	111_K	0.574	0.32
11_F	80_V	0.572	0.31
8_K	12_N	0.563	0.31
52_I	103_I	0.560	0.31
31_A	34_D	0.560	0.31
18_L	22_I	0.559	0.30
9_L	13_E	0.553	0.30
37_E	40_R	0.551	0.30
31_A	61_T	0.551	0.30
24_S	48_P	0.547	0.30
41_K	97_V	0.547	0.30
86_V	94_P	0.547	0.30
31_A	74_L	0.546	0.29
67_N	100_E	0.544	0.29
89_I	92_R	0.543	0.29
38_N	76_L	0.536	0.29
56_N	75_P	0.534	0.29
9_L	81_W	0.533	0.29
30_F	60_G	0.531	0.28
10_G	90_G	0.531	0.28
21_R	25_S	0.530	0.28
49_T	105_N	0.528	0.28
9_L	78_F	0.527	0.28
30_F	55_G	0.524	0.28
78_F	118_G	0.524	0.28
50_I	88_K	0.523	0.28
32_I	52_I	0.516	0.27
43_G	95_S	0.513	0.27
78_F	98_G	0.512	0.27
16_K	24_S	0.511	0.27
97_V	101_Y	0.509	0.27
44_L	51_V	0.505	0.27
12_N	40_R	0.505	0.27
31_A	43_G	0.503	0.26
40_R	96_E	0.502	0.26
15_V	52_I	0.500	0.26

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1j3mA	2	0.9919	99.9	0.435	Contact Map
1q9uA	2	0.9919	99.9	0.449	Contact Map
1vl6A	4	0.9187	69.2	0.91	Contact Map
2hxsA	1	0.6585	56.1	0.917	Contact Map
2nvuB	1	0.9675	37.8	0.926	Contact Map
1z0jA	1	0.6585	31.9	0.929	Contact Map
2blnA	1	0.5366	27.8	0.931	Contact Map
1u8zA	1	0.6179	21.2	0.934	Contact Map
1pujA	1	0.8455	20.2	0.935	Contact Map
4m8nE	1	0.6341	20.1	0.935	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.