Q97ZA8 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97ZA8 - Formate hydrogenlyase subunit 7 (HycG)

UniProt:	Q97ZA8	Sequences: MKNWWFIRGLRKGVMTEKYPKEIAEWSTEIQGEGTVNCPTNAIKDGKWIKERCVFCRRCYPNYRPNLNPRIYTINKTQPLFKRSFYLYPIDSGTCGGCNMELKLISSPEYDMTRFSIFFTNTPRHADALVVMGVMTEKMKEVLKKAYEAMPEPKVVILLGACAISGGIIGEGVPLEAVVEIPGCPPNPFTILEALMKVKGK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	201 (173)
Sequences:	226 (161)
Seq/√Len:	12.2

ECOLI - HYCG HYFI NUOB
HALSA - Q9HRM0
SULSO - Q97ZA8 Q7LXP2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
31_Q	34_G	4.492	1.00
162_C	184_C	4.261	1.00
95_C	162_C	3.881	0.99
98_C	184_C	3.609	0.99
95_C	184_C	3.475	0.98
98_C	162_C	3.350	0.98
101_E	104_L	2.779	0.94
104_L	107_S	2.612	0.91
101_E	107_S	2.567	0.91
40_T	165_S	2.563	0.91
95_C	98_C	2.447	0.88
53_C	56_C	2.406	0.87
93_G	136_T	2.365	0.87
53_C	59_C	2.305	0.85
52_R	181_I	2.188	0.82
111_D	125_H	2.069	0.78
144_K	148_E	1.996	0.75
56_C	59_C	1.951	0.73
102_L	130_V	1.937	0.73
140_K	144_K	1.767	0.66
91_D	94_T	1.760	0.65
38_C	56_C	1.726	0.64
38_C	59_C	1.644	0.60
187_N	190_T	1.640	0.60
156_V	177_A	1.551	0.55
51_E	99_N	1.519	0.54
113_T	118_F	1.504	0.53
38_C	53_C	1.503	0.53
193_E	197_K	1.498	0.53
124_R	149_A	1.495	0.52
80_L	115_F	1.486	0.52
137_E	140_K	1.484	0.52
162_C	186_P	1.462	0.51
147_Y	156_V	1.449	0.50
179_V	198_V	1.422	0.49
97_G	162_C	1.414	0.48
173_V	179_V	1.375	0.46
90_I	135_M	1.352	0.45
112_M	117_I	1.344	0.45
129_L	175_L	1.340	0.45
98_C	186_P	1.336	0.44
76_K	79_P	1.281	0.42
69_P	73_T	1.272	0.41
124_R	182_P	1.267	0.41
57_R	111_D	1.266	0.41
131_V	177_A	1.257	0.40
74_I	115_F	1.251	0.40
36_V	41_N	1.238	0.39
90_I	139_M	1.230	0.39
154_K	187_N	1.218	0.39
121_N	194_A	1.217	0.38
79_P	200_G	1.213	0.38
105_I	117_I	1.201	0.38
124_R	136_T	1.198	0.38
174_P	195_L	1.195	0.37
52_R	114_R	1.190	0.37
97_G	184_C	1.187	0.37
125_H	138_K	1.182	0.37
88_Y	122_T	1.175	0.36
88_Y	132_M	1.172	0.36
112_M	115_F	1.170	0.36
54_V	59_C	1.166	0.36
39_P	53_C	1.166	0.36
88_Y	99_N	1.164	0.36
92_S	99_N	1.134	0.35
152_E	171_E	1.133	0.35
141_E	145_K	1.131	0.34
126_A	188_P	1.111	0.34
87_L	91_D	1.079	0.32
56_C	126_A	1.075	0.32
74_I	157_I	1.075	0.32
147_Y	154_K	1.072	0.32
130_V	191_I	1.069	0.32
117_I	195_L	1.067	0.32
49_I	56_C	1.061	0.31
62_N	179_V	1.040	0.30
108_P	193_E	1.035	0.30
106_S	118_F	1.018	0.29
120_T	180_E	1.017	0.29
59_C	84_S	1.017	0.29
86_Y	89_P	1.010	0.29
115_F	196_M	1.009	0.29
53_C	126_A	1.004	0.29
35_T	64_R	1.003	0.29
86_Y	108_P	1.002	0.29
102_L	191_I	0.999	0.29
96_G	138_K	0.993	0.28
34_G	37_N	0.993	0.28
98_C	136_T	0.983	0.28
181_I	194_A	0.976	0.28
151_P	175_L	0.970	0.27
90_I	126_A	0.968	0.27
75_N	196_M	0.963	0.27
135_M	175_L	0.963	0.27
86_Y	113_T	0.961	0.27
39_P	56_C	0.954	0.27
79_P	117_I	0.942	0.26
136_T	176_E	0.938	0.26
58_R	108_P	0.938	0.26
124_R	190_T	0.935	0.26
51_E	164_I	0.922	0.26
39_P	128_A	0.921	0.26
113_T	120_T	0.914	0.25
157_I	167_G	0.913	0.25
71_I	195_L	0.907	0.25
71_I	188_P	0.906	0.25
135_M	146_A	0.893	0.24
41_N	52_R	0.888	0.24
49_I	59_C	0.886	0.24
64_R	75_N	0.876	0.24
56_C	188_P	0.875	0.24
84_S	117_I	0.872	0.24
130_V	139_M	0.869	0.24
107_S	145_K	0.867	0.24
121_N	142_V	0.866	0.23
54_V	87_L	0.862	0.23
152_E	194_A	0.854	0.23
34_G	96_G	0.853	0.23
165_S	168_I	0.851	0.23
33_E	47_K	0.850	0.23
120_T	142_V	0.850	0.23
103_K	120_T	0.849	0.23
97_G	186_P	0.844	0.23
64_R	67_L	0.832	0.22
57_R	60_Y	0.827	0.22
88_Y	121_N	0.823	0.22
111_D	138_K	0.822	0.22
84_S	126_A	0.821	0.22
173_V	190_T	0.817	0.22
93_G	114_R	0.814	0.22
56_C	84_S	0.805	0.21
171_E	199_K	0.796	0.21
63_Y	117_I	0.795	0.21
131_V	172_G	0.791	0.21
57_R	81_F	0.790	0.21
33_E	63_Y	0.790	0.21
47_K	62_N	0.789	0.21
40_T	43_I	0.788	0.21
112_M	196_M	0.788	0.21
94_T	103_K	0.785	0.21
66_N	71_I	0.783	0.21
31_Q	35_T	0.781	0.21
179_V	195_L	0.779	0.20
94_T	104_L	0.779	0.20
110_Y	187_N	0.776	0.20
42_A	53_C	0.771	0.20
29_E	32_G	0.766	0.20
89_P	94_T	0.766	0.20
95_C	186_P	0.766	0.20
110_Y	191_I	0.759	0.20
139_M	167_G	0.755	0.20
143_L	178_V	0.753	0.20
55_F	115_F	0.751	0.20
81_F	167_G	0.748	0.19
150_M	198_V	0.742	0.19
141_E	172_G	0.739	0.19
35_T	58_R	0.737	0.19
100_M	109_E	0.735	0.19
87_L	157_I	0.723	0.19
139_M	157_I	0.716	0.18
40_T	200_G	0.711	0.18
182_P	190_T	0.707	0.18
32_G	45_D	0.705	0.18
53_C	188_P	0.704	0.18
90_I	99_N	0.703	0.18
75_N	145_K	0.699	0.18
110_Y	179_V	0.699	0.18
95_C	161_A	0.697	0.18
66_N	73_T	0.695	0.18
142_V	194_A	0.694	0.18
159_L	191_I	0.693	0.18
146_A	188_P	0.690	0.18
108_P	170_G	0.689	0.18
163_A	181_I	0.684	0.18
122_T	142_V	0.680	0.17
81_F	134_V	0.677	0.17
75_N	129_L	0.672	0.17
156_V	175_L	0.672	0.17
73_T	181_I	0.671	0.17
63_Y	106_S	0.660	0.17
59_C	188_P	0.656	0.17
132_M	177_A	0.656	0.17
36_V	44_K	0.656	0.17
125_H	159_L	0.652	0.17
161_A	164_I	0.652	0.17
126_A	146_A	0.651	0.17
49_I	53_C	0.648	0.16
63_Y	79_P	0.648	0.16
87_L	128_A	0.647	0.16
46_G	65_P	0.645	0.16
89_P	132_M	0.645	0.16
84_S	95_C	0.644	0.16
44_K	60_Y	0.644	0.16
106_S	117_I	0.641	0.16
41_N	140_K	0.630	0.16
84_S	112_M	0.630	0.16
40_T	51_E	0.628	0.16
88_Y	92_S	0.626	0.16
42_A	84_S	0.625	0.16
136_T	184_C	0.623	0.16
140_K	148_E	0.619	0.16
137_E	180_E	0.619	0.16
83_R	177_A	0.619	0.16
80_L	126_A	0.618	0.16
76_K	110_Y	0.613	0.16
148_E	169_I	0.612	0.15
134_V	139_M	0.610	0.15
99_N	139_M	0.609	0.15
150_M	174_P	0.601	0.15
152_E	200_G	0.601	0.15
32_G	44_K	0.600	0.15
91_D	170_G	0.599	0.15
129_L	156_V	0.598	0.15
53_C	84_S	0.597	0.15
86_Y	94_T	0.595	0.15
48_W	56_C	0.594	0.15
99_N	197_K	0.590	0.15
38_C	49_I	0.589	0.15
52_R	82_K	0.586	0.15
105_I	188_P	0.584	0.15
146_A	149_A	0.576	0.15
173_V	177_A	0.574	0.15
186_P	194_A	0.572	0.14
169_I	201_K	0.564	0.14
77_T	147_Y	0.564	0.14
54_V	57_R	0.561	0.14
85_F	128_A	0.560	0.14
39_P	59_C	0.555	0.14
76_K	200_G	0.554	0.14
94_T	110_Y	0.554	0.14
37_N	41_N	0.553	0.14
140_K	172_G	0.552	0.14
53_C	195_L	0.552	0.14
137_E	198_V	0.551	0.14
100_M	139_M	0.551	0.14
55_F	125_H	0.548	0.14
90_I	146_A	0.543	0.14
37_N	47_K	0.543	0.14
158_L	186_P	0.542	0.14
129_L	151_P	0.541	0.14
46_G	148_E	0.541	0.14
125_H	155_V	0.538	0.14
49_I	57_R	0.536	0.14
63_Y	76_K	0.534	0.14
172_G	178_V	0.525	0.13
35_T	136_T	0.524	0.13
30_I	141_E	0.523	0.13
97_G	161_A	0.522	0.13
131_V	158_L	0.521	0.13
52_R	59_C	0.520	0.13
85_F	132_M	0.518	0.13
58_R	115_F	0.516	0.13
31_Q	61_P	0.513	0.13
34_G	95_C	0.510	0.13
117_I	126_A	0.508	0.13
34_G	162_C	0.506	0.13
84_S	188_P	0.506	0.13
55_F	59_C	0.505	0.13
40_T	76_K	0.502	0.13
121_N	125_H	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3i9v6	1	0.5821	100	0.548	Contact Map
4ue3S	2	0.597	100	0.621	Contact Map
3ayxB	2	0.592	100	0.622	Contact Map
3myrA	3	0.597	100	0.626	Contact Map
4uqlA	1	0.597	100	0.629	Contact Map
1h2aS	1	0.6119	100	0.63	Contact Map
2wpnA	1	0.5871	100	0.631	Contact Map
4u9hS	1	0.602	100	0.632	Contact Map
1yq9A	2	0.597	100	0.635	Contact Map
4kn9S	1	0.597	100	0.639	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0074 seconds.