Y1041 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Y1041 - UPF0200 protein SSO1041

UniProt:	Q97Z90	Sequences: MSYLVVTIKVILITGMPGSGKSEFAKLLKERGAKVIVMSDVVRKRYSIEAKPGERLMDFAKRLREIYGDGVVARLCVEELGTSNHDLVVFDGVRSLAEVEEFKRLLGDSVYIVAVHSPPKIRYKRMIERLRSDDSKEISELIRRDREELKLGIGEVIAMADYIITNDSNYEEFKRRCEEVTDRVLKNG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	188 (171)
Sequences:	6332 (3851)
Seq/√Len:	294.5

ECOLI - KAD AROL AROK
BACSU - KAD AROK YQAC
HALSA - Y2452 KAD KCY KAD6
SULSO - Y1041 KCY KAD6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
62_R	65_E	3.832	1.00
119_P	149_L	3.406	1.00
57_M	61_K	2.846	1.00
30_E	178_E	2.838	1.00
42_V	72_V	2.625	1.00
116_H	163_I	2.556	1.00
59_F	68_G	2.492	1.00
26_K	174_K	2.440	1.00
168_S	176_R	2.440	1.00
44_K	48_I	2.413	1.00
158_A	163_I	2.164	1.00
146_R	150_K	2.148	1.00
73_A	93_V	2.100	1.00
168_S	172_E	2.053	1.00
114_A	163_I	2.011	1.00
45_R	78_E	1.964	1.00
46_Y	60_A	1.870	1.00
103_K	106_L	1.866	1.00
126_M	141_L	1.861	1.00
134_D	137_E	1.854	1.00
121_I	124_K	1.819	1.00
55_R	58_D	1.802	1.00
30_E	174_K	1.779	1.00
115_V	166_N	1.778	1.00
162_Y	180_V	1.774	1.00
118_P	167_D	1.771	1.00
58_D	62_R	1.762	1.00
111_Y	162_Y	1.760	1.00
79_E	83_S	1.744	1.00
169_N	172_E	1.733	1.00
73_A	101_E	1.724	1.00
138_I	142_I	1.715	1.00
49_E	54_E	1.685	1.00
123_Y	142_I	1.685	1.00
79_E	82_T	1.671	1.00
26_K	171_E	1.657	1.00
31_R	178_E	1.640	1.00
51_K	55_R	1.578	1.00
51_K	54_E	1.566	1.00
121_I	167_D	1.524	1.00
55_R	74_R	1.503	1.00
143_R	146_R	1.502	1.00
19_S	117_S	1.466	1.00
151_L	155_E	1.436	1.00
65_E	143_R	1.435	1.00
77_V	105_L	1.412	1.00
174_K	178_E	1.404	1.00
114_A	154_G	1.367	1.00
24_F	177_C	1.339	1.00
155_E	159_M	1.334	1.00
77_V	81_G	1.327	1.00
13_I	25_A	1.323	1.00
128_E	131_R	1.310	1.00
137_E	140_E	1.307	1.00
103_K	160_A	1.299	1.00
77_V	104_R	1.293	1.00
45_R	50_A	1.275	1.00
26_K	29_K	1.255	1.00
127_I	138_I	1.250	1.00
81_G	105_L	1.221	1.00
156_V	160_A	1.206	1.00
59_F	65_E	1.189	1.00
175_R	179_E	1.188	1.00
172_E	176_R	1.182	1.00
18_G	126_M	1.170	1.00
74_R	77_V	1.156	1.00
115_V	177_C	1.150	1.00
168_S	173_F	1.143	1.00
117_S	166_N	1.143	1.00
119_P	142_I	1.137	1.00
97_A	100_E	1.137	1.00
45_R	75_L	1.124	1.00
50_A	53_G	1.113	1.00
175_R	178_E	1.112	1.00
45_R	48_I	1.111	1.00
155_E	158_A	1.104	1.00
145_D	149_L	1.085	1.00
14_T	154_G	1.085	1.00
96_L	100_E	1.068	1.00
34_K	79_E	1.066	1.00
143_R	147_E	1.060	1.00
49_E	57_M	1.055	1.00
68_G	71_V	1.050	1.00
34_K	84_N	1.048	1.00
16_M	148_E	1.045	1.00
165_T	168_S	1.026	1.00
119_P	146_R	1.019	1.00
56_L	59_F	1.014	1.00
120_K	124_K	1.013	1.00
39_S	43_R	1.009	1.00
10_V	88_V	1.009	1.00
176_R	179_E	1.007	1.00
10_V	110_V	1.002	1.00
36_I	79_E	0.997	1.00
13_I	27_L	0.992	1.00
127_I	130_L	0.984	1.00
69_D	95_S	0.965	1.00
56_L	60_A	0.962	1.00
123_Y	138_I	0.955	1.00
12_L	109_S	0.955	1.00
119_P	145_D	0.954	1.00
22_S	91_D	0.937	1.00
55_R	70_G	0.935	1.00
78_E	82_T	0.932	1.00
58_D	61_K	0.926	1.00
172_E	175_R	0.926	1.00
14_T	112_I	0.907	1.00
54_E	57_M	0.904	1.00
99_V	156_V	0.902	1.00
16_M	122_R	0.876	1.00
41_V	75_L	0.871	1.00
24_F	174_K	0.871	1.00
113_V	177_C	0.867	1.00
70_G	74_R	0.852	1.00
127_I	137_E	0.846	1.00
28_L	35_V	0.841	1.00
140_E	143_R	0.840	1.00
73_A	76_C	0.838	1.00
44_K	79_E	0.837	1.00
69_D	98_E	0.834	1.00
103_K	108_D	0.833	1.00
132_S	135_S	0.824	1.00
33_A	88_V	0.822	1.00
72_V	76_C	0.816	1.00
165_T	176_R	0.814	1.00
69_D	97_A	0.812	1.00
55_R	59_F	0.811	1.00
54_E	58_D	0.808	1.00
116_H	154_G	0.808	1.00
52_P	74_R	0.806	1.00
165_T	173_F	0.801	1.00
20_G	23_E	0.799	0.99
153_I	157_I	0.787	0.99
130_L	133_D	0.781	0.99
103_K	157_I	0.780	0.99
71_V	74_R	0.769	0.99
170_Y	174_K	0.763	0.99
13_I	89_V	0.759	0.99
123_Y	127_I	0.759	0.99
88_V	109_S	0.759	0.99
25_A	35_V	0.758	0.99
33_A	87_L	0.756	0.99
32_G	86_D	0.750	0.99
13_I	113_V	0.749	0.99
164_I	173_F	0.744	0.99
46_Y	57_M	0.743	0.99
39_S	94_R	0.741	0.99
127_I	132_S	0.736	0.99
37_V	40_D	0.736	0.99
41_V	45_R	0.720	0.99
56_L	75_L	0.712	0.99
42_V	76_C	0.706	0.99
44_K	82_T	0.704	0.99
13_I	115_V	0.703	0.99
11_I	111_Y	0.702	0.99
99_V	157_I	0.702	0.99
176_R	180_V	0.700	0.99
16_M	19_S	0.697	0.99
56_L	74_R	0.697	0.99
133_D	136_K	0.693	0.99
99_V	102_F	0.690	0.99
164_I	180_V	0.689	0.99
27_L	89_V	0.686	0.98
102_F	106_L	0.685	0.98
127_I	131_R	0.671	0.98
46_Y	49_E	0.669	0.98
38_M	76_C	0.669	0.98
142_I	146_R	0.669	0.98
131_R	134_D	0.669	0.98
12_L	112_I	0.660	0.98
103_K	156_V	0.658	0.98
78_E	81_G	0.656	0.98
15_G	19_S	0.652	0.98
20_G	125_R	0.652	0.98
100_E	156_V	0.652	0.98
42_V	56_L	0.651	0.98
124_K	128_E	0.644	0.98
111_Y	181_T	0.643	0.98
48_I	82_T	0.641	0.98
120_K	142_I	0.640	0.98
34_K	83_S	0.638	0.98
111_Y	180_V	0.636	0.97
117_S	122_R	0.632	0.97
31_R	174_K	0.629	0.97
45_R	56_L	0.626	0.97
28_L	34_K	0.625	0.97
36_I	41_V	0.624	0.97
42_V	46_Y	0.624	0.97
28_L	89_V	0.623	0.97
26_K	30_E	0.621	0.97
136_K	145_D	0.618	0.97
42_V	60_A	0.615	0.97
167_D	173_F	0.612	0.97
96_L	156_V	0.610	0.97
46_Y	53_G	0.607	0.97
24_F	173_F	0.603	0.97
80_L	84_N	0.599	0.96
120_K	123_Y	0.598	0.96
171_E	175_R	0.595	0.96
10_V	109_S	0.594	0.96
52_P	55_R	0.592	0.96
147_E	150_K	0.591	0.96
41_V	79_E	0.591	0.96
118_P	121_I	0.590	0.96
59_F	71_V	0.588	0.96
136_K	140_E	0.586	0.96
52_P	78_E	0.585	0.96
67_Y	72_V	0.583	0.96
79_E	84_N	0.580	0.96
18_G	141_L	0.580	0.96
17_P	140_E	0.579	0.96
79_E	87_L	0.574	0.95
158_A	161_D	0.573	0.95
13_I	28_L	0.572	0.95
98_E	102_F	0.570	0.95
66_I	94_R	0.570	0.95
10_V	107_G	0.569	0.95
27_L	177_C	0.563	0.95
45_R	53_G	0.561	0.95
152_G	155_E	0.556	0.95
95_S	98_E	0.556	0.95
24_F	125_R	0.556	0.95
132_S	137_E	0.555	0.95
95_S	102_F	0.551	0.94
129_R	136_K	0.551	0.94
10_V	76_C	0.547	0.94
35_V	40_D	0.544	0.94
146_R	149_L	0.541	0.94
55_R	71_V	0.540	0.94
16_M	89_V	0.537	0.94
61_K	134_D	0.537	0.94
96_L	153_I	0.536	0.93
102_F	109_S	0.534	0.93
23_E	125_R	0.533	0.93
129_R	144_R	0.532	0.93
65_E	68_G	0.531	0.93
100_E	103_K	0.531	0.93
11_I	181_T	0.526	0.93
17_P	122_R	0.526	0.93
139_S	143_R	0.525	0.93
116_H	165_T	0.524	0.93
69_D	101_E	0.524	0.93
15_G	18_G	0.523	0.93
100_E	155_E	0.520	0.92
123_Y	141_L	0.520	0.92
113_V	162_Y	0.517	0.92
84_N	87_L	0.514	0.92
105_L	108_D	0.514	0.92
42_V	67_Y	0.508	0.92
10_V	102_F	0.507	0.91
34_K	87_L	0.507	0.91
49_E	53_G	0.505	0.91
25_A	28_L	0.502	0.91
128_E	132_S	0.502	0.91
96_L	99_V	0.501	0.91
119_P	123_Y	0.500	0.91

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3gmtA	1	0.8351	99.9	0.428	Contact Map
4qbgB	1	0.9415	99.9	0.444	Contact Map
2c95A	1	0.984	99.9	0.45	Contact Map
1ukzA	1	0.9787	99.9	0.454	Contact Map
1zakA	2	0.9681	99.9	0.454	Contact Map
4jzkA	1	0.9202	99.9	0.455	Contact Map
3be4A	1	0.9309	99.9	0.457	Contact Map
4pzlA	2	0.9681	99.9	0.458	Contact Map
1akyA	1	0.9415	99.9	0.461	Contact Map
3tlxA	1	0.9681	99.9	0.462	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.