Y1042 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Y1042 - UPF0201 protein SSO1042

UniProt:	Q97Z89	Sequences: MVKVMVVAEVRPSEDVNKVLSAISNFFDFEKMNTRKEGIIDILVLEARTLKSLLKFHRVLRNERILDSARKYLMKGIEGNTIAFMIHKQAAAVGVLSFVDSDKESPLGAIKFYIEYQNPKEIVDWLAPKTAHGVPLWDNPVPPDV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	145 (127)
Sequences:	159 (124)
Seq/√Len:	11.0

HALSA - Q9HMN9
SULSO - Y1042

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
57_H	126_L	2.532	0.87
6_V	23_I	2.529	0.87
31_K	68_S	2.328	0.82
130_T	133_G	2.168	0.77
56_F	96_L	2.080	0.74
99_V	109_A	2.078	0.74
69_A	98_F	2.070	0.74
19_V	22_A	1.993	0.71
67_D	98_F	1.980	0.70
8_A	23_I	1.971	0.70
61_R	66_L	1.949	0.69
65_I	69_A	1.934	0.68
60_L	66_L	1.906	0.67
67_D	130_T	1.836	0.64
84_F	112_F	1.732	0.59
20_L	93_V	1.725	0.59
60_L	69_A	1.710	0.58
11_R	59_V	1.700	0.58
66_L	133_G	1.691	0.57
4_V	10_V	1.679	0.57
84_F	98_F	1.662	0.56
4_V	96_L	1.629	0.55
94_G	126_L	1.597	0.53
70_R	128_P	1.574	0.52
13_S	97_S	1.535	0.50
87_H	112_F	1.501	0.48
27_F	112_F	1.471	0.47
45_L	55_K	1.461	0.46
74_M	124_D	1.435	0.45
105_S	109_A	1.424	0.45
96_L	127_A	1.404	0.44
66_L	135_P	1.379	0.43
86_I	96_L	1.377	0.43
5_M	44_V	1.368	0.42
17_N	21_S	1.359	0.42
47_A	111_K	1.357	0.42
65_I	98_F	1.351	0.41
66_L	128_P	1.348	0.41
65_I	70_R	1.347	0.41
23_I	60_L	1.343	0.41
24_S	96_L	1.324	0.40
23_I	114_I	1.276	0.38
10_V	94_G	1.265	0.37
26_F	119_P	1.260	0.37
45_L	103_K	1.259	0.37
52_S	86_I	1.252	0.37
33_N	79_G	1.247	0.37
10_V	19_V	1.234	0.36
67_D	133_G	1.231	0.36
19_V	91_A	1.209	0.35
20_L	118_N	1.190	0.34
118_N	121_E	1.186	0.34
24_S	29_F	1.179	0.34
116_Y	119_P	1.178	0.34
22_A	79_G	1.169	0.33
132_H	136_L	1.168	0.33
68_S	112_F	1.156	0.33
8_A	56_F	1.153	0.32
68_S	97_S	1.128	0.31
7_V	74_M	1.102	0.30
90_A	108_G	1.094	0.30
63_E	96_L	1.088	0.30
30_E	118_N	1.080	0.29
99_V	105_S	1.073	0.29
15_D	18_K	1.065	0.29
66_L	130_T	1.060	0.29
108_G	114_I	1.055	0.28
33_N	76_G	1.049	0.28
51_K	56_F	1.032	0.28
57_H	125_W	1.020	0.27
82_I	119_P	1.018	0.27
85_M	111_K	1.015	0.27
87_H	105_S	1.008	0.27
51_K	73_L	0.993	0.26
65_I	97_S	0.987	0.26
26_F	43_L	0.984	0.26
92_A	96_L	0.983	0.26
16_V	37_E	0.966	0.25
22_A	27_F	0.961	0.25
27_F	91_A	0.956	0.25
26_F	99_V	0.941	0.24
57_H	61_R	0.939	0.24
63_E	66_L	0.935	0.24
32_M	35_R	0.924	0.24
103_K	115_E	0.922	0.24
59_V	62_N	0.916	0.23
77_I	125_W	0.908	0.23
19_V	110_I	0.893	0.23
77_I	122_I	0.890	0.22
78_E	81_T	0.887	0.22
72_Y	94_G	0.883	0.22
60_L	65_I	0.872	0.22
4_V	78_E	0.871	0.22
5_M	117_Q	0.869	0.22
35_R	47_A	0.861	0.22
90_A	105_S	0.858	0.21
67_D	76_G	0.852	0.21
51_K	54_L	0.846	0.21
7_V	43_L	0.846	0.21
6_V	43_L	0.841	0.21
64_R	102_D	0.828	0.20
47_A	52_S	0.822	0.20
55_K	77_I	0.821	0.20
70_R	124_D	0.820	0.20
27_F	84_F	0.817	0.20
91_A	110_I	0.815	0.20
27_F	90_A	0.814	0.20
90_A	95_V	0.814	0.20
94_G	108_G	0.807	0.20
53_L	125_W	0.805	0.20
8_A	13_S	0.794	0.19
97_S	109_A	0.787	0.19
128_P	133_G	0.786	0.19
26_F	126_L	0.783	0.19
57_H	136_L	0.782	0.19
54_L	96_L	0.781	0.19
75_K	93_V	0.780	0.19
26_F	62_N	0.780	0.19
58_R	64_R	0.777	0.19
63_E	95_V	0.762	0.18
84_F	108_G	0.759	0.18
22_A	91_A	0.757	0.18
11_R	52_S	0.744	0.18
61_R	70_R	0.735	0.18
10_V	22_A	0.734	0.18
44_V	79_G	0.727	0.17
57_H	135_P	0.727	0.17
10_V	34_T	0.726	0.17
36_K	117_Q	0.724	0.17
53_L	110_I	0.723	0.17
64_R	121_E	0.720	0.17
112_F	120_K	0.717	0.17
28_D	68_S	0.715	0.17
25_N	126_L	0.711	0.17
20_L	24_S	0.698	0.17
98_F	128_P	0.694	0.17
15_D	20_L	0.684	0.16
116_Y	122_I	0.683	0.16
104_E	109_A	0.683	0.16
26_F	132_H	0.678	0.16
71_K	129_K	0.676	0.16
46_E	81_T	0.671	0.16
13_S	17_N	0.662	0.16
79_G	92_A	0.655	0.16
60_L	135_P	0.650	0.15
96_L	134_V	0.648	0.15
55_K	58_R	0.641	0.15
25_N	85_M	0.633	0.15
52_S	77_I	0.630	0.15
59_V	63_E	0.626	0.15
26_F	135_P	0.616	0.15
4_V	32_M	0.612	0.15
6_V	72_Y	0.606	0.14
99_V	126_L	0.604	0.14
11_R	26_F	0.604	0.14
16_V	112_F	0.602	0.14
20_L	34_T	0.602	0.14
23_I	28_D	0.600	0.14
60_L	97_S	0.590	0.14
19_V	56_F	0.590	0.14
61_R	128_P	0.590	0.14
76_G	113_Y	0.584	0.14
53_L	81_T	0.577	0.14
98_F	130_T	0.574	0.14
18_K	106_P	0.569	0.14
17_N	115_E	0.567	0.13
73_L	80_N	0.563	0.13
13_S	65_I	0.563	0.13
55_K	59_V	0.560	0.13
65_I	128_P	0.558	0.13
21_S	45_L	0.551	0.13
98_F	127_A	0.550	0.13
33_N	58_R	0.546	0.13
70_R	130_T	0.544	0.13
11_R	115_E	0.539	0.13
20_L	32_M	0.538	0.13
38_G	113_Y	0.538	0.13
63_E	133_G	0.535	0.13
25_N	32_M	0.532	0.13
124_D	134_V	0.532	0.13
57_H	124_D	0.530	0.13
28_D	54_L	0.525	0.13
90_A	93_V	0.525	0.13
67_D	128_P	0.516	0.12
80_N	123_V	0.511	0.12
23_I	76_G	0.510	0.12
32_M	75_K	0.507	0.12
38_G	43_L	0.507	0.12
19_V	100_D	0.506	0.12
105_S	119_P	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2nwuA	2	0.9241	100	0.219	Contact Map
3d7aA	2	0.9241	100	0.274	Contact Map
3c9gA	2	0.8759	100	0.278	Contact Map
2pzzA	2	0.8897	100	0.313	Contact Map
2ogkA	4	0.8552	100	0.496	Contact Map
2wnyA	1	0.8276	100	0.528	Contact Map
2nrqA	1	0.8069	100	0.533	Contact Map
2fgcA	2	0.4828	21.8	0.947	Contact Map
1sflA	2	0.9448	8.9	0.955	Contact Map
4cu7A	1	0.7379	8.1	0.956	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.