Q97Z73 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97Z73 - Uncharacterized protein

UniProt:	Q97Z73	Sequences: MTVITFTAEGRLDGDKVIVDLNGTEIKVGLLGSDNPTPEEFCLASAISCLILTVYYIAREKGVTINSIEGYIEGKMDTKGFQGVEEVPPGLLEVSYELIVYSKDSRISDILKEAEERCPMRDTLTRSVKVNINWKIKS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	138 (130)
Sequences:	963 (721)
Seq/√Len:	63.2

SULSO - Q97Z73

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
103_K	106_R	4.692	1.00
66_N	101_Y	4.662	1.00
75_K	95_S	3.863	1.00
104_D	108_S	3.488	1.00
73_E	95_S	2.879	1.00
42_C	124_L	2.789	1.00
88_P	122_D	2.602	1.00
80_G	87_V	2.495	1.00
102_S	107_I	2.358	1.00
106_R	109_D	2.145	1.00
93_E	131_N	2.020	1.00
65_I	68_I	2.001	1.00
30_L	33_S	1.937	1.00
27_K	35_N	1.932	1.00
88_P	126_R	1.901	1.00
69_E	99_I	1.890	1.00
30_L	34_D	1.824	1.00
28_V	48_S	1.760	1.00
108_S	112_K	1.686	0.99
18_I	25_E	1.685	0.99
53_T	118_C	1.656	0.99
47_I	72_I	1.612	0.99
71_Y	99_I	1.598	0.99
22_N	40_E	1.585	0.99
26_I	44_A	1.552	0.99
10_G	47_I	1.542	0.99
90_G	122_D	1.521	0.99
42_C	123_T	1.517	0.99
11_R	69_E	1.514	0.98
77_D	87_V	1.492	0.98
63_V	106_R	1.468	0.98
97_E	133_N	1.399	0.97
71_Y	97_E	1.394	0.97
42_C	45_S	1.390	0.97
19_V	44_A	1.389	0.97
57_I	117_R	1.385	0.97
93_E	129_K	1.350	0.97
26_I	41_F	1.337	0.97
79_K	84_V	1.269	0.95
61_K	113_E	1.267	0.95
115_E	118_C	1.257	0.95
63_V	110_I	1.257	0.95
9_E	71_Y	1.251	0.95
54_V	110_I	1.202	0.94
50_L	96_Y	1.170	0.93
88_P	128_V	1.164	0.93
11_R	97_E	1.136	0.92
46_A	94_V	1.135	0.92
67_S	101_Y	1.115	0.91
6_F	39_E	1.108	0.91
66_N	102_S	1.096	0.91
80_G	89_P	1.094	0.90
61_K	109_D	1.093	0.90
13_D	18_I	1.090	0.90
17_V	52_L	1.089	0.90
9_E	69_E	1.089	0.90
83_G	90_G	1.088	0.90
75_K	93_E	1.061	0.89
36_P	113_E	1.058	0.89
6_F	31_L	1.048	0.88
54_V	114_A	1.048	0.88
79_K	87_V	1.044	0.88
12_L	55_Y	1.043	0.88
122_D	126_R	1.035	0.88
53_T	57_I	1.014	0.87
63_V	102_S	1.011	0.87
39_E	120_M	0.990	0.85
103_K	108_S	0.981	0.85
21_L	44_A	0.973	0.84
59_R	118_C	0.952	0.83
43_L	74_G	0.933	0.82
60_E	117_R	0.924	0.81
16_K	27_K	0.917	0.81
112_K	116_E	0.887	0.78
11_R	18_I	0.885	0.78
39_E	76_M	0.879	0.78
81_F	119_P	0.850	0.75
19_V	48_S	0.850	0.75
57_I	60_E	0.846	0.75
37_T	81_F	0.841	0.75
31_L	81_F	0.839	0.75
5_T	73_E	0.837	0.74
54_V	98_L	0.827	0.73
30_L	82_Q	0.826	0.73
8_A	21_L	0.825	0.73
43_L	94_V	0.819	0.73
54_V	111_L	0.816	0.72
26_I	36_P	0.816	0.72
37_T	40_E	0.813	0.72
54_V	68_I	0.807	0.72
72_I	96_Y	0.793	0.70
20_D	25_E	0.790	0.70
43_L	119_P	0.788	0.70
10_G	96_Y	0.784	0.69
20_D	23_G	0.781	0.69
52_L	81_F	0.764	0.67
18_I	27_K	0.763	0.67
12_L	17_V	0.762	0.67
12_L	15_D	0.760	0.67
69_E	86_E	0.757	0.67
95_S	131_N	0.755	0.66
55_Y	118_C	0.739	0.65
69_E	92_L	0.731	0.64
71_Y	104_D	0.730	0.64
61_K	110_I	0.727	0.64
73_E	97_E	0.726	0.63
10_G	19_V	0.721	0.63
8_A	123_T	0.718	0.63
57_I	83_G	0.715	0.62
68_I	71_Y	0.712	0.62
90_G	123_T	0.712	0.62
67_S	97_E	0.710	0.62
28_V	41_F	0.696	0.60
94_V	124_L	0.693	0.60
7_T	73_E	0.693	0.60
37_T	119_P	0.689	0.59
108_S	133_N	0.682	0.59
105_S	109_D	0.680	0.58
105_S	112_K	0.676	0.58
99_I	112_K	0.673	0.58
29_G	32_G	0.669	0.57
95_S	133_N	0.668	0.57
78_T	118_C	0.667	0.57
115_E	121_R	0.665	0.57
111_L	123_T	0.663	0.56
25_E	109_D	0.659	0.56
114_A	118_C	0.659	0.56
33_S	118_C	0.659	0.56
29_G	40_E	0.658	0.56
108_S	111_L	0.652	0.55
40_E	122_D	0.647	0.55
38_P	44_A	0.646	0.55
41_F	48_S	0.645	0.54
8_A	12_L	0.640	0.54
60_E	78_T	0.640	0.54
74_G	94_V	0.631	0.53
15_D	35_N	0.630	0.53
56_Y	81_F	0.621	0.52
6_F	78_T	0.620	0.52
37_T	120_M	0.617	0.51
120_M	124_L	0.616	0.51
70_G	98_L	0.616	0.51
11_R	62_G	0.616	0.51
109_D	112_K	0.613	0.51
24_T	31_L	0.611	0.51
48_S	119_P	0.610	0.50
11_R	14_G	0.610	0.50
61_K	106_R	0.602	0.49
64_T	102_S	0.600	0.49
13_D	16_K	0.599	0.49
11_R	20_D	0.594	0.49
88_P	123_T	0.593	0.48
93_E	128_V	0.591	0.48
50_L	132_I	0.591	0.48
121_R	130_V	0.590	0.48
89_P	117_R	0.584	0.47
93_E	133_N	0.584	0.47
36_P	79_K	0.583	0.47
23_G	34_D	0.581	0.47
5_T	75_K	0.576	0.46
116_E	129_K	0.570	0.46
58_A	131_N	0.570	0.46
54_V	100_V	0.563	0.45
78_T	84_V	0.561	0.45
85_E	116_E	0.561	0.45
37_T	76_M	0.559	0.45
54_V	117_R	0.558	0.44
31_L	40_E	0.557	0.44
99_I	108_S	0.550	0.44
51_I	68_I	0.547	0.43
24_T	29_G	0.545	0.43
7_T	116_E	0.540	0.42
14_G	99_I	0.540	0.42
28_V	122_D	0.537	0.42
21_L	36_P	0.537	0.42
103_K	126_R	0.533	0.42
19_V	28_V	0.529	0.41
38_P	81_F	0.527	0.41
53_T	81_F	0.524	0.41
10_G	17_V	0.522	0.40
123_T	128_V	0.520	0.40
7_T	71_Y	0.519	0.40
121_R	125_T	0.516	0.40
65_I	111_L	0.516	0.40
102_S	110_I	0.516	0.40
24_T	132_I	0.513	0.39
114_A	119_P	0.512	0.39
112_K	115_E	0.511	0.39
57_I	81_F	0.510	0.39
17_V	21_L	0.509	0.39
77_D	116_E	0.508	0.39
77_D	96_Y	0.503	0.38
41_F	96_Y	0.502	0.38
110_I	120_M	0.501	0.38
107_I	134_W	0.500	0.38

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2oplA	2	0.9928	100	0.397	Contact Map
1lqlA	2	0.971	99.9	0.46	Contact Map
2onfA	2	0.9493	99.9	0.479	Contact Map
3cjeA	2	0.9638	99.9	0.48	Contact Map
1ml8A	2	0.8841	99.9	0.483	Contact Map
1ukkA	2	0.9058	99.9	0.485	Contact Map
2d7vA	2	0.8986	99.9	0.494	Contact Map
3eerA	2	0.942	99.9	0.495	Contact Map
1qwiA	2	0.9275	99.9	0.498	Contact Map
4mh4A	2	0.913	99.9	0.503	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.