Q97Z66 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97Z66 - Molybdenum transport protein ModA related protein (ModA)

UniProt:	Q97Z66	Sequences: MRFRFKIWIEAEDGKPLIGKGGVKLLRAIEETGSLSSASKSLGVSYKFAWEYVKRINEILSDSVEMRKGGKNAGGSKVNEKLDKLLNIYEEAQKEISEILEKYNKKINEVLNQEGEKA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	118 (102)
Sequences:	1104 (815)
Seq/√Len:	80.7

ECOLI - MODE
SULSO - Q97Z66

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
30_E	83_D	5.684	1.00
27_R	90_E	5.560	1.00
23_V	86_L	3.455	1.00
47_K	51_E	2.783	1.00
31_E	41_S	2.492	1.00
36_S	40_K	2.484	1.00
28_A	31_E	2.160	1.00
95_E	103_Y	2.118	1.00
48_F	52_Y	2.029	1.00
84_K	88_I	1.956	1.00
25_L	49_A	1.908	1.00
21_G	44_V	1.872	1.00
28_A	42_L	1.845	1.00
39_S	49_A	1.834	1.00
54_K	58_E	1.801	1.00
24_K	28_A	1.779	1.00
21_G	42_L	1.758	1.00
56_I	63_S	1.746	1.00
80_E	83_D	1.715	1.00
37_S	40_K	1.685	1.00
65_E	77_K	1.607	1.00
28_A	41_S	1.510	0.99
32_T	41_S	1.459	0.99
70_G	74_G	1.423	0.99
70_G	73_A	1.346	0.99
28_A	32_T	1.287	0.98
92_A	100_L	1.285	0.98
22_G	52_Y	1.260	0.98
44_V	48_F	1.235	0.97
95_E	98_E	1.225	0.97
22_G	56_I	1.200	0.97
20_K	93_Q	1.195	0.97
96_I	99_I	1.186	0.97
29_I	53_V	1.185	0.97
29_I	64_V	1.148	0.96
90_E	93_Q	1.148	0.96
22_G	48_F	1.094	0.95
20_K	89_Y	1.091	0.95
63_S	82_L	1.082	0.95
18_I	23_V	1.049	0.94
60_L	63_S	1.027	0.93
8_W	21_G	1.025	0.93
69_G	74_G	1.022	0.93
48_F	51_E	1.016	0.93
10_E	16_P	0.997	0.92
36_S	47_K	0.992	0.92
78_V	86_L	0.982	0.91
57_N	61_S	0.971	0.91
80_E	84_K	0.962	0.90
96_I	100_L	0.954	0.90
87_N	91_E	0.951	0.90
10_E	15_K	0.949	0.90
93_Q	97_S	0.942	0.89
82_L	86_L	0.938	0.89
97_S	101_E	0.936	0.89
34_S	75_G	0.929	0.89
35_L	47_K	0.913	0.88
95_E	102_K	0.895	0.87
36_S	76_S	0.886	0.86
63_S	85_L	0.885	0.86
91_E	94_K	0.881	0.86
102_K	105_K	0.868	0.85
53_V	57_N	0.867	0.85
44_V	52_Y	0.863	0.85
22_G	55_R	0.862	0.85
12_E	15_K	0.862	0.85
83_D	87_N	0.858	0.84
47_K	57_N	0.841	0.83
5_F	8_W	0.840	0.83
30_E	78_V	0.822	0.82
27_R	86_L	0.819	0.82
43_G	72_N	0.809	0.81
92_A	103_Y	0.808	0.81
17_L	29_I	0.805	0.81
35_L	53_V	0.797	0.80
103_Y	106_K	0.796	0.80
6_K	10_E	0.784	0.79
47_K	50_W	0.784	0.79
53_V	64_V	0.783	0.79
94_K	98_E	0.768	0.77
95_E	106_K	0.763	0.77
30_E	105_K	0.762	0.77
98_E	102_K	0.761	0.77
9_I	25_L	0.737	0.74
39_S	48_F	0.715	0.72
42_L	58_E	0.714	0.72
57_N	62_D	0.703	0.71
89_Y	93_Q	0.696	0.70
63_S	81_K	0.684	0.69
17_L	60_L	0.682	0.69
81_K	85_L	0.681	0.68
88_I	107_I	0.678	0.68
64_V	68_K	0.671	0.67
44_V	50_W	0.670	0.67
67_R	77_K	0.653	0.65
52_Y	56_I	0.651	0.65
55_R	59_I	0.643	0.64
5_F	96_I	0.635	0.63
51_E	71_K	0.626	0.62
54_K	57_N	0.624	0.62
6_K	12_E	0.620	0.61
35_L	40_K	0.618	0.61
19_G	42_L	0.617	0.61
47_K	52_Y	0.609	0.60
26_L	64_V	0.608	0.60
29_I	39_S	0.606	0.59
64_V	82_L	0.606	0.59
99_I	104_N	0.603	0.59
63_S	78_V	0.602	0.59
5_F	100_L	0.601	0.59
71_K	88_I	0.601	0.59
36_S	64_V	0.600	0.59
53_V	62_D	0.600	0.59
16_P	55_R	0.596	0.58
17_L	99_I	0.593	0.58
66_M	95_E	0.590	0.57
17_L	59_I	0.589	0.57
24_K	42_L	0.589	0.57
39_S	46_Y	0.584	0.57
22_G	47_K	0.583	0.57
26_L	56_I	0.583	0.57
95_E	99_I	0.579	0.56
77_K	83_D	0.578	0.56
33_G	87_N	0.576	0.56
8_W	60_L	0.573	0.55
35_L	76_S	0.572	0.55
33_G	63_S	0.567	0.54
16_P	48_F	0.565	0.54
6_K	17_L	0.563	0.54
84_K	102_K	0.557	0.53
7_I	93_Q	0.556	0.53
13_D	59_I	0.555	0.53
49_A	75_G	0.554	0.53
40_K	50_W	0.552	0.53
27_R	31_E	0.552	0.53
81_K	87_N	0.552	0.53
88_I	91_E	0.549	0.52
51_E	55_R	0.547	0.52
62_D	74_G	0.534	0.50
9_I	82_L	0.533	0.50
8_W	12_E	0.530	0.50
77_K	94_K	0.527	0.49
81_K	88_I	0.524	0.49
92_A	104_N	0.520	0.48
38_A	101_E	0.518	0.48
21_G	48_F	0.515	0.48
63_S	77_K	0.512	0.47
43_G	48_F	0.509	0.47
26_L	78_V	0.504	0.46
78_V	82_L	0.504	0.46
37_S	75_G	0.504	0.46
43_G	106_K	0.500	0.46
78_V	95_E	0.500	0.46

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ijlA	2	0.9237	99.7	0.541	Contact Map
1b9mA	2	0.9492	99.6	0.585	Contact Map
3szpA	3	0.7881	98.7	0.731	Contact Map
3mz1A	2	0.0593	98.6	0.737	Contact Map
1ixcA	4	0.7627	98.6	0.737	Contact Map
4x6gA	4	0.822	98.6	0.738	Contact Map
1uthA	2	0.178	98.6	0.74	Contact Map
2h98A	2	0.0508	98.6	0.74	Contact Map
4pzjA	2	0.5847	98.6	0.741	Contact Map
3fxqA	3	0.7966	98.6	0.742	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.