Q97Z65 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97Z65 - Intracellular proteinase

UniProt:	Q97Z65	Sequences: MDSKKVLFLVGEEFEDIELLYPFYRVMEEGFKPVIAWKEANSKVIGKHGYTVISDIAFKDVRPEDYIALVIPGGRGPEHIRTLEEVKNITRKFFELKKPVAAICHGPQILISANLVKGRKLTSVNSIKDDVIAAGGIYVDNDVVVDENLISSRVPSDLPAFASTLIKALKSIK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	173 (161)
Sequences:	14732 (9848)
Seq/√Len:	776.1

ECOLI - YHBO YAJL HCHA
BACSU - YRAA GS18 YOAZ YDEA
HALSA - Q9HMG4 Q9HRT2
SULSO - Q97Z65

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
5_K	32_K	2.815	1.00
164_T	167_K	2.722	1.00
7_L	66_Y	2.671	1.00
34_V	66_Y	2.454	1.00
7_L	36_A	2.428	1.00
119_R	147_E	2.416	1.00
145_V	168_A	2.294	1.00
120_K	139_V	2.256	1.00
119_R	146_D	2.243	1.00
5_K	34_V	2.219	1.00
116_V	121_L	2.181	1.00
34_V	56_I	2.175	1.00
145_V	164_T	1.995	1.00
43_K	53_I	1.985	1.00
25_R	166_I	1.944	1.00
128_K	132_I	1.914	1.00
117_K	137_I	1.914	1.00
29_E	166_I	1.786	1.00
94_F	148_N	1.762	1.00
119_R	149_L	1.750	1.00
120_K	137_I	1.711	1.00
23_F	27_M	1.689	1.00
93_F	98_K	1.612	1.00
94_F	100_V	1.587	1.00
120_K	146_D	1.573	1.00
142_D	160_A	1.565	1.00
145_V	150_I	1.563	1.00
38_K	83_L	1.556	1.00
130_D	134_A	1.553	1.00
102_A	151_S	1.535	1.00
14_F	46_G	1.499	1.00
45_I	51_T	1.496	1.00
57_A	60_D	1.485	1.00
16_D	20_L	1.468	1.00
68_A	99_P	1.451	1.00
8_F	70_V	1.449	1.00
99_P	168_A	1.445	1.00
88_N	92_K	1.416	1.00
101_A	165_L	1.387	1.00
130_D	133_A	1.384	1.00
89_I	93_F	1.383	1.00
43_K	51_T	1.374	1.00
59_K	85_E	1.370	1.00
131_V	140_D	1.366	1.00
37_W	40_A	1.363	1.00
119_R	148_N	1.355	1.00
152_S	157_D	1.343	1.00
8_F	23_F	1.339	1.00
141_N	160_A	1.337	1.00
150_I	168_A	1.335	1.00
87_K	91_R	1.327	1.00
102_A	110_L	1.298	1.00
101_A	161_F	1.297	1.00
92_K	96_L	1.296	1.00
112_S	134_A	1.289	1.00
84_E	88_N	1.289	1.00
121_L	138_Y	1.287	1.00
94_F	149_L	1.251	1.00
85_E	88_N	1.245	1.00
94_F	115_L	1.232	1.00
56_I	60_D	1.227	1.00
131_V	136_G	1.225	1.00
88_N	91_R	1.213	1.00
145_V	148_N	1.200	1.00
97_K	148_N	1.200	1.00
6_V	68_A	1.197	1.00
51_T	55_D	1.189	1.00
12_E	45_I	1.170	1.00
14_F	19_L	1.162	1.00
26_V	162_A	1.160	1.00
10_V	35_I	1.153	1.00
97_K	100_V	1.132	1.00
87_K	113_A	1.129	1.00
17_I	21_Y	1.119	1.00
19_L	35_I	1.117	1.00
21_Y	159_P	1.112	1.00
128_K	140_D	1.099	1.00
82_T	112_S	1.096	1.00
111_I	138_Y	1.085	1.00
164_T	168_A	1.083	1.00
150_I	161_F	1.069	1.00
24_Y	28_E	1.068	1.00
91_R	95_E	1.064	1.00
92_K	95_E	1.058	1.00
40_A	57_A	1.054	1.00
21_Y	24_Y	1.054	1.00
120_K	144_V	1.048	1.00
9_L	86_V	1.041	1.00
23_F	35_I	1.039	1.00
16_D	50_Y	1.036	1.00
114_N	117_K	1.034	1.00
105_H	127_I	1.032	1.00
67_I	98_K	1.032	1.00
94_F	97_K	1.028	1.00
70_V	161_F	1.025	1.00
108_Q	130_D	1.016	1.00
10_V	19_L	1.012	1.00
21_Y	162_A	0.999	1.00
120_K	141_N	0.987	1.00
36_A	56_I	0.974	1.00
152_S	161_F	0.970	1.00
129_D	133_A	0.965	1.00
124_V	154_V	0.962	1.00
143_V	164_T	0.958	1.00
8_F	33_P	0.943	1.00
99_P	148_N	0.942	1.00
38_K	85_E	0.941	1.00
71_I	90_T	0.915	1.00
81_R	112_S	0.914	1.00
25_R	162_A	0.910	1.00
150_I	165_L	0.894	1.00
102_A	107_P	0.889	1.00
56_I	61_V	0.888	1.00
14_F	52_V	0.885	1.00
31_F	68_A	0.874	1.00
6_V	31_F	0.873	1.00
153_R	157_D	0.869	1.00
22_P	70_V	0.865	1.00
159_P	163_S	0.865	1.00
93_F	96_L	0.850	1.00
99_P	150_I	0.850	1.00
38_K	58_F	0.849	1.00
71_I	109_I	0.844	1.00
127_I	130_D	0.841	1.00
24_Y	27_M	0.839	1.00
22_P	158_L	0.836	1.00
12_E	39_E	0.834	1.00
107_P	123_S	0.834	1.00
68_A	165_L	0.830	1.00
87_K	112_S	0.816	1.00
21_Y	158_L	0.814	1.00
112_S	135_G	0.805	1.00
36_A	61_V	0.805	1.00
23_F	33_P	0.799	1.00
19_L	23_F	0.799	1.00
37_W	54_S	0.794	1.00
14_F	72_P	0.793	1.00
142_D	145_V	0.791	1.00
70_V	101_A	0.790	1.00
136_G	140_D	0.784	1.00
10_V	14_F	0.781	1.00
31_F	166_I	0.779	1.00
135_G	138_Y	0.779	1.00
122_T	144_V	0.774	1.00
8_F	19_L	0.771	1.00
71_I	86_V	0.770	1.00
69_L	93_F	0.762	1.00
83_L	86_V	0.753	1.00
66_Y	93_F	0.742	1.00
131_V	135_G	0.738	1.00
68_A	101_A	0.738	1.00
103_I	158_L	0.736	1.00
89_I	92_K	0.735	1.00
64_E	92_K	0.734	1.00
121_L	136_G	0.730	1.00
99_P	165_L	0.722	1.00
26_V	165_L	0.717	1.00
16_D	46_G	0.715	1.00
91_R	113_A	0.714	1.00
43_K	54_S	0.714	1.00
108_Q	127_I	0.711	1.00
71_I	106_G	0.706	1.00
7_L	61_V	0.704	1.00
125_N	138_Y	0.696	1.00
25_R	163_S	0.695	1.00
90_T	109_I	0.692	1.00
94_F	119_R	0.683	1.00
150_I	164_T	0.677	1.00
102_A	106_G	0.676	1.00
65_D	96_L	0.673	1.00
34_V	55_D	0.664	1.00
122_T	138_Y	0.660	1.00
40_A	54_S	0.659	1.00
110_L	113_A	0.658	1.00
142_D	157_D	0.656	1.00
129_D	132_I	0.653	1.00
141_N	144_V	0.650	1.00
16_D	48_H	0.645	1.00
26_V	31_F	0.643	1.00
118_G	137_I	0.643	1.00
6_V	26_V	0.643	1.00
13_E	45_I	0.638	1.00
123_S	138_Y	0.637	1.00
61_V	66_Y	0.634	1.00
160_A	163_S	0.622	1.00
125_N	154_V	0.621	1.00
84_E	87_K	0.615	1.00
87_K	90_T	0.615	1.00
158_L	162_A	0.609	1.00
87_K	109_I	0.605	1.00
139_V	142_D	0.602	1.00
25_R	29_E	0.601	1.00
66_Y	69_L	0.600	1.00
126_S	129_D	0.599	1.00
80_I	83_L	0.592	1.00
78_E	82_T	0.591	1.00
5_K	67_I	0.585	1.00
9_L	36_A	0.584	1.00
64_E	96_L	0.579	1.00
121_L	131_V	0.578	1.00
103_I	161_F	0.578	1.00
8_F	22_P	0.578	1.00
45_I	49_G	0.573	1.00
90_T	113_A	0.572	1.00
18_E	155_P	0.569	1.00
18_E	73_G	0.567	1.00
79_H	82_T	0.566	1.00
15_E	24_Y	0.561	1.00
90_T	115_L	0.561	1.00
27_M	33_P	0.558	1.00
100_V	149_L	0.553	1.00
111_I	131_V	0.550	1.00
132_I	138_Y	0.548	1.00
25_R	28_E	0.548	1.00
117_K	135_G	0.547	1.00
41_N	53_I	0.547	1.00
82_T	87_K	0.545	1.00
101_A	150_I	0.543	1.00
111_I	116_V	0.543	1.00
39_E	57_A	0.533	1.00
61_V	64_E	0.531	1.00
100_V	148_N	0.531	1.00
91_R	115_L	0.529	1.00
160_A	164_T	0.529	1.00
123_S	127_I	0.529	1.00
124_V	155_P	0.528	1.00
7_L	89_I	0.526	1.00
58_F	86_V	0.526	1.00
107_P	131_V	0.524	1.00
143_V	150_I	0.523	1.00
9_L	69_L	0.519	1.00
10_V	44_V	0.517	1.00
37_W	55_D	0.515	1.00
25_R	159_P	0.514	1.00
22_P	26_V	0.509	1.00
17_I	158_L	0.509	1.00
21_Y	25_R	0.507	1.00
163_S	167_K	0.504	1.00
91_R	114_N	0.503	1.00
36_A	66_Y	0.503	1.00
40_A	60_D	0.500	1.00
23_F	50_Y	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3l18A	2	0.9711	100	0.162	Contact Map
2rk3A	2	0.9942	100	0.165	Contact Map
1oi4A	2	0.9827	100	0.166	Contact Map
3fseA	2	0.9884	100	0.166	Contact Map
3mgkA	2	0.9769	100	0.171	Contact Map
3er6A	2	0.9769	100	0.175	Contact Map
3ewnA	2	0.9884	100	0.175	Contact Map
2vrnA	2	0.9942	100	0.179	Contact Map
3noqA	2	0.9769	100	0.18	Contact Map
3graA	2	0.9653	100	0.181	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.