Q97Z60 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97Z60 - First ORF in transposon ISC1904

UniProt:	Q97Z60	Sequences: MGIIRKRKVILYARVSSNTQKDDLVNQVKYLEEQVKEYDQVITDIGSKLNMKRKGFLKLLRMILNNEVSRVVVAYPDKLVRFGFEILEETYKAHGCEIVVINQEDKTPEELVEDLVSTLVSFSGKLYGMRSHKYEKVKKCAEELKN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	146 (132)
Sequences:	477 (298)
Seq/√Len:	25.9

SULSO - Q97Z60 Q97YH2 Q97XB5 Q97U52 Q97U67 Q97YI6 Q97XI0 Q97UQ9 Q97YU0 Q97YX0 Q97XQ1 Q97XZ4 Q97X40 Q97Y49 Q7LXE3 Q97X25 Q97X27 Q97WZ4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
9_V	70_R	4.159	1.00
13_A	31_L	3.759	1.00
70_R	97_E	3.586	1.00
35_V	72_V	3.555	1.00
56_F	79_L	2.906	1.00
11_L	101_I	2.695	0.99
63_I	91_Y	2.599	0.99
88_E	92_K	2.552	0.99
64_L	94_H	2.508	0.99
44_D	55_G	2.476	0.99
28_V	41_V	2.246	0.98
30_Y	74_A	2.162	0.97
11_L	31_L	2.137	0.97
51_M	85_E	1.995	0.95
11_L	41_V	1.944	0.95
59_L	68_V	1.899	0.94
84_F	98_I	1.875	0.93
42_I	55_G	1.845	0.93
28_V	43_T	1.697	0.89
40_Q	62_M	1.684	0.89
91_Y	96_C	1.649	0.88
49_L	82_F	1.603	0.87
8_K	62_M	1.572	0.85
115_L	119_L	1.488	0.82
91_Y	123_S	1.479	0.82
25_V	29_K	1.476	0.82
75_Y	113_E	1.472	0.81
51_M	121_S	1.437	0.80
60_L	64_L	1.423	0.79
35_V	38_Y	1.414	0.79
49_L	83_G	1.410	0.78
72_V	99_V	1.393	0.78
44_D	74_A	1.345	0.75
9_V	97_E	1.344	0.75
38_Y	95_G	1.332	0.74
80_V	87_L	1.325	0.74
29_K	32_E	1.319	0.74
91_Y	126_L	1.312	0.73
63_I	71_V	1.312	0.73
62_M	67_E	1.307	0.73
63_I	68_V	1.303	0.73
72_V	85_E	1.274	0.71
63_I	96_C	1.235	0.68
121_S	124_G	1.229	0.68
15_V	24_L	1.213	0.67
82_F	114_D	1.202	0.66
48_K	79_L	1.198	0.66
95_G	115_L	1.186	0.65
9_V	72_V	1.185	0.65
10_I	59_L	1.178	0.65
11_L	35_V	1.144	0.62
111_L	122_F	1.138	0.62
15_V	20_Q	1.128	0.61
61_R	93_A	1.103	0.59
51_M	80_V	1.100	0.59
109_E	113_E	1.097	0.59
20_Q	23_D	1.090	0.59
74_A	132_H	1.083	0.58
70_R	99_V	1.082	0.58
120_V	131_S	1.070	0.57
80_V	84_F	1.065	0.57
29_K	33_E	1.058	0.56
84_F	100_V	1.053	0.56
50_N	94_H	1.028	0.54
71_V	98_I	1.027	0.54
86_I	108_P	0.999	0.52
7_R	96_C	0.990	0.51
12_Y	15_V	0.989	0.51
37_E	72_V	0.989	0.51
63_I	73_V	0.976	0.50
64_L	90_T	0.961	0.49
127_Y	130_R	0.960	0.49
71_V	137_V	0.957	0.49
34_Q	99_V	0.953	0.49
34_Q	102_N	0.949	0.48
44_D	121_S	0.944	0.48
131_S	137_V	0.930	0.47
10_I	42_I	0.919	0.46
10_I	28_V	0.910	0.45
23_D	26_N	0.908	0.45
31_L	101_I	0.905	0.45
73_V	98_I	0.903	0.45
46_G	117_S	0.898	0.44
7_R	65_N	0.897	0.44
118_T	128_G	0.894	0.44
9_V	69_S	0.877	0.43
8_K	69_S	0.861	0.42
26_N	29_K	0.847	0.41
42_I	59_L	0.843	0.41
19_T	75_Y	0.828	0.39
34_Q	101_I	0.828	0.39
39_D	56_F	0.826	0.39
80_V	117_S	0.820	0.39
75_Y	107_T	0.814	0.38
56_F	121_S	0.800	0.37
30_Y	132_H	0.786	0.37
73_V	97_E	0.773	0.36
30_Y	102_N	0.770	0.35
106_K	129_M	0.768	0.35
52_K	125_K	0.755	0.34
100_V	119_L	0.752	0.34
107_T	132_H	0.746	0.34
26_N	116_V	0.744	0.34
56_F	80_V	0.742	0.34
87_L	91_Y	0.739	0.33
82_F	118_T	0.736	0.33
88_E	105_D	0.735	0.33
16_S	20_Q	0.727	0.33
60_L	99_V	0.726	0.33
110_E	122_F	0.725	0.32
25_V	28_V	0.724	0.32
120_V	124_G	0.716	0.32
57_L	87_L	0.705	0.31
100_V	108_P	0.700	0.31
64_L	86_I	0.699	0.31
102_N	106_K	0.692	0.30
125_K	129_M	0.690	0.30
57_L	89_E	0.690	0.30
52_K	116_V	0.690	0.30
18_N	66_N	0.684	0.30
46_G	100_V	0.682	0.30
42_I	71_V	0.682	0.30
7_R	95_G	0.681	0.30
114_D	128_G	0.677	0.29
71_V	113_E	0.676	0.29
7_R	110_E	0.676	0.29
111_L	120_V	0.674	0.29
17_S	26_N	0.669	0.29
92_K	125_K	0.667	0.29
31_L	96_C	0.667	0.29
105_D	119_L	0.657	0.28
114_D	118_T	0.653	0.28
50_N	59_L	0.648	0.28
39_D	72_V	0.642	0.27
135_E	139_K	0.636	0.27
8_K	39_D	0.635	0.27
30_Y	117_S	0.635	0.27
17_S	20_Q	0.633	0.27
34_Q	70_R	0.633	0.27
83_G	123_S	0.629	0.27
74_A	120_V	0.629	0.27
71_V	79_L	0.629	0.27
55_G	73_V	0.623	0.26
115_L	128_G	0.622	0.26
18_N	21_K	0.619	0.26
28_V	32_E	0.617	0.26
124_G	129_M	0.617	0.26
58_K	126_L	0.603	0.25
42_I	57_L	0.600	0.25
88_E	99_V	0.591	0.24
52_K	94_H	0.589	0.24
82_F	128_G	0.589	0.24
49_L	110_E	0.586	0.24
8_K	40_Q	0.586	0.24
54_K	69_S	0.581	0.24
51_M	57_L	0.579	0.24
51_M	71_V	0.577	0.24
88_E	98_I	0.576	0.24
39_D	69_S	0.570	0.23
48_K	56_F	0.567	0.23
112_V	128_G	0.566	0.23
9_V	46_G	0.563	0.23
87_L	111_L	0.562	0.23
96_C	110_E	0.560	0.23
80_V	128_G	0.560	0.23
42_I	62_M	0.560	0.23
61_R	89_E	0.558	0.23
35_V	74_A	0.557	0.23
11_L	102_N	0.554	0.22
111_L	114_D	0.552	0.22
67_E	107_T	0.550	0.22
72_V	101_I	0.550	0.22
82_F	111_L	0.549	0.22
90_T	93_A	0.548	0.22
33_E	37_E	0.547	0.22
76_P	119_L	0.545	0.22
22_D	26_N	0.544	0.22
124_G	128_G	0.542	0.22
59_L	138_K	0.539	0.22
132_H	138_K	0.535	0.22
113_E	124_G	0.535	0.22
21_K	97_E	0.533	0.21
46_G	97_E	0.531	0.21
13_A	24_L	0.530	0.21
125_K	128_G	0.529	0.21
22_D	58_K	0.522	0.21
45_I	53_R	0.521	0.21
101_I	108_P	0.520	0.21
76_P	115_L	0.516	0.21
20_Q	47_S	0.514	0.21
74_A	124_G	0.513	0.20
53_R	80_V	0.512	0.20
25_V	43_T	0.511	0.20
38_Y	53_R	0.506	0.20
41_V	64_L	0.505	0.20
124_G	131_S	0.502	0.20
22_D	118_T	0.500	0.20
56_F	69_S	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ilxA	2	0.9521	99.9	0.547	Contact Map
3lhkA	2	0.9658	99.9	0.554	Contact Map
3g13A	2	0.9658	99.8	0.648	Contact Map
3bvpA	4	0.8562	99.8	0.657	Contact Map
3guvA	2	0.9315	99.8	0.663	Contact Map
4bqqA	2	0.911	99.8	0.671	Contact Map
2mhcA	1	0.7397	99.8	0.675	Contact Map
2gm5A	4	0.8356	99.7	0.679	Contact Map
1gdtA	2	0.911	99.7	0.679	Contact Map
3pkzA	4	0.774	99.7	0.692	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.