Q97Z59 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97Z59 - Uncharacterized protein

UniProt:	Q97Z59	Sequences: MAIKIVFFHDVLCPFCFVTSRRLRKVVNKFKEEVVVKHKAFMIISSLEDLKAAAPTEEEAKEIFKQEFSIIKRYYPDYDPEKVIGKGKIIWVWSLPPLIACKAAEYQRGDNGYWDYFDKAQEKFFLEGENVNDDNILIQIAEELGLDVEKFKEDFKSKKARMSVFEDEAEAHAMGIRGVPALLVNDYWLIRGVQEETYLESVIEDLLSNGGEPKKVKLKAYWEAT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	225 (204)
Sequences:	3700 (2846)
Seq/√Len:	199.3

BACSU - YWBO
SULSO - Q97Z59

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
129_E	139_Q	3.499	1.00
29_K	200_E	3.217	1.00
122_E	127_E	3.015	1.00
22_R	83_V	2.754	1.00
181_A	189_L	2.728	1.00
138_I	152_K	2.727	1.00
6_V	37_K	2.719	1.00
4_K	35_V	2.715	1.00
6_V	39_K	2.701	1.00
119_K	143_E	2.686	1.00
4_K	37_K	2.564	1.00
99_I	134_D	2.475	1.00
142_E	148_V	2.440	1.00
116_Y	144_L	2.310	1.00
11_V	104_A	2.285	1.00
11_V	100_A	2.263	1.00
110_D	150_K	2.193	1.00
134_D	156_K	2.094	1.00
98_L	165_F	2.037	1.00
20_S	24_R	1.988	1.00
141_A	151_F	1.930	1.00
21_R	118_D	1.910	1.00
129_E	136_I	1.891	1.00
112_G	115_D	1.783	1.00
169_A	173_A	1.727	1.00
104_A	117_F	1.713	1.00
123_K	140_I	1.711	1.00
130_N	133_D	1.705	1.00
103_A	116_Y	1.698	1.00
5_I	23_L	1.697	1.00
91_W	128_G	1.697	1.00
162_M	166_E	1.695	1.00
27_V	34_V	1.683	1.00
119_K	140_I	1.681	1.00
148_V	152_K	1.673	1.00
98_L	161_R	1.635	1.00
40_A	167_D	1.624	1.00
20_S	118_D	1.612	1.00
116_Y	120_A	1.601	1.00
139_Q	148_V	1.575	1.00
42_M	168_E	1.569	1.00
109_G	163_S	1.555	1.00
108_R	113_Y	1.544	1.00
135_N	152_K	1.532	1.00
39_K	170_E	1.525	1.00
107_Q	111_N	1.523	1.00
30_F	204_E	1.514	1.00
103_A	151_F	1.505	1.00
119_K	127_E	1.496	1.00
59_E	63_I	1.473	1.00
86_K	126_L	1.419	1.00
147_D	150_K	1.407	1.00
103_A	137_L	1.399	1.00
88_K	91_W	1.378	1.00
6_V	186_D	1.337	1.00
117_F	121_Q	1.333	1.00
170_E	174_M	1.327	1.00
39_K	167_D	1.304	1.00
104_A	116_Y	1.297	1.00
52_A	60_A	1.282	1.00
38_H	114_W	1.281	1.00
138_I	148_V	1.281	1.00
182_L	199_L	1.280	1.00
9_H	117_F	1.262	1.00
123_K	129_E	1.261	1.00
40_A	105_E	1.247	1.00
122_E	126_L	1.239	1.00
102_K	158_K	1.231	1.00
154_D	160_A	1.218	1.00
178_G	181_A	1.206	1.00
99_I	102_K	1.204	1.00
158_K	162_M	1.196	1.00
22_R	195_E	1.175	1.00
184_V	202_V	1.164	1.00
30_F	200_E	1.152	1.00
152_K	156_K	1.146	1.00
74_Y	77_D	1.135	1.00
18_V	75_Y	1.133	1.00
79_D	87_G	1.130	1.00
194_Q	198_Y	1.121	1.00
37_K	108_R	1.103	1.00
42_M	165_F	1.100	1.00
139_Q	143_E	1.094	1.00
190_I	202_V	1.088	1.00
30_F	207_L	1.082	1.00
166_E	170_E	1.069	1.00
25_K	83_V	1.068	1.00
32_E	207_L	1.067	1.00
73_R	77_D	1.062	1.00
153_E	159_K	1.042	1.00
105_E	167_D	1.041	1.00
26_V	196_E	1.037	1.00
123_K	136_I	1.033	1.00
79_D	85_G	1.033	1.00
150_K	159_K	1.029	1.00
11_V	117_F	1.027	1.00
68_F	72_K	1.009	1.00
24_R	118_D	1.007	1.00
200_E	204_E	1.003	1.00
109_G	160_A	0.998	1.00
104_A	113_Y	0.996	1.00
140_I	144_L	0.996	1.00
25_K	28_N	0.986	1.00
16_C	179_V	0.986	1.00
69_S	73_R	0.986	1.00
59_E	65_K	0.986	1.00
58_E	63_I	0.984	1.00
23_L	36_V	0.983	1.00
24_R	114_W	0.980	1.00
67_E	70_I	0.976	0.99
15_F	78_Y	0.975	0.99
49_D	99_I	0.974	0.99
165_F	168_E	0.973	0.99
42_M	98_L	0.973	0.99
8_F	171_A	0.972	0.99
12_L	97_P	0.969	0.99
25_K	29_K	0.965	0.99
88_K	128_G	0.958	0.99
120_A	137_L	0.955	0.99
76_P	81_E	0.945	0.99
119_K	144_L	0.945	0.99
70_I	74_Y	0.932	0.99
183_L	189_L	0.927	0.99
53_A	56_T	0.927	0.99
54_A	57_E	0.924	0.99
120_A	131_V	0.922	0.99
17_F	126_L	0.919	0.99
22_R	78_Y	0.919	0.99
11_V	120_A	0.914	0.99
169_A	172_H	0.910	0.99
100_A	131_V	0.899	0.99
134_D	138_I	0.894	0.99
150_K	153_E	0.888	0.99
170_E	186_D	0.885	0.99
136_I	139_Q	0.884	0.99
58_E	61_K	0.877	0.99
21_R	24_R	0.876	0.99
95_L	132_N	0.875	0.99
134_D	152_K	0.870	0.99
174_M	183_L	0.870	0.99
53_A	57_E	0.868	0.99
170_E	173_A	0.856	0.99
196_E	200_E	0.856	0.99
44_I	47_L	0.855	0.99
97_P	101_C	0.854	0.99
139_Q	142_E	0.853	0.99
17_F	85_G	0.851	0.99
188_W	206_L	0.849	0.99
106_Y	154_D	0.848	0.99
59_E	62_E	0.842	0.99
149_E	153_E	0.841	0.98
105_E	108_R	0.835	0.98
27_V	36_V	0.832	0.98
42_M	96_P	0.832	0.98
8_F	183_L	0.829	0.98
105_E	160_A	0.828	0.98
25_K	196_E	0.827	0.98
74_Y	78_Y	0.825	0.98
47_L	94_S	0.819	0.98
73_R	76_P	0.818	0.98
181_A	191_R	0.816	0.98
202_V	205_D	0.815	0.98
119_K	123_K	0.815	0.98
138_I	142_E	0.814	0.98
7_F	23_L	0.806	0.98
198_Y	201_S	0.803	0.98
178_G	191_R	0.802	0.98
107_Q	146_L	0.802	0.98
20_S	38_H	0.801	0.98
161_R	165_F	0.799	0.98
57_E	63_I	0.798	0.98
12_L	94_S	0.793	0.98
7_F	38_H	0.792	0.98
59_E	64_F	0.788	0.98
79_D	89_I	0.787	0.98
163_S	166_E	0.780	0.98
103_A	120_A	0.772	0.97
11_V	131_V	0.772	0.97
106_Y	151_F	0.772	0.97
20_S	114_W	0.771	0.97
184_V	199_L	0.770	0.97
100_A	137_L	0.769	0.97
8_F	40_A	0.763	0.97
184_V	190_I	0.756	0.97
116_Y	141_A	0.753	0.97
106_Y	160_A	0.748	0.97
71_I	75_Y	0.747	0.97
106_Y	110_D	0.745	0.97
9_H	121_Q	0.745	0.97
201_S	205_D	0.744	0.97
81_E	86_K	0.735	0.96
90_I	128_G	0.735	0.96
92_V	128_G	0.734	0.96
120_A	140_I	0.731	0.96
103_A	155_F	0.719	0.96
22_R	196_E	0.712	0.96
67_E	71_I	0.709	0.96
138_I	141_A	0.709	0.96
19_T	182_L	0.706	0.96
191_R	194_Q	0.706	0.96
71_I	74_Y	0.704	0.96
153_E	157_S	0.703	0.95
38_H	117_F	0.701	0.95
77_D	81_E	0.700	0.95
106_Y	150_K	0.698	0.95
30_F	34_V	0.691	0.95
64_F	68_F	0.690	0.95
150_K	154_D	0.689	0.95
140_I	143_E	0.687	0.95
112_G	144_L	0.683	0.95
5_I	34_V	0.680	0.95
11_V	15_F	0.679	0.95
57_E	62_E	0.677	0.94
119_K	122_E	0.670	0.94
17_F	122_E	0.663	0.94
136_I	140_I	0.661	0.94
195_E	198_Y	0.660	0.94
3_I	34_V	0.654	0.93
4_K	186_D	0.654	0.93
201_S	204_E	0.651	0.93
166_E	173_A	0.648	0.93
88_K	126_L	0.645	0.93
75_Y	87_G	0.644	0.93
116_Y	140_I	0.643	0.93
7_F	182_L	0.642	0.93
23_L	27_V	0.641	0.93
149_E	152_K	0.639	0.93
58_E	62_E	0.639	0.93
66_Q	69_S	0.631	0.92
8_F	39_K	0.628	0.92
9_H	16_C	0.626	0.92
102_K	159_K	0.621	0.92
10_D	97_P	0.610	0.91
203_I	207_L	0.610	0.91
29_K	196_E	0.609	0.91
57_E	60_A	0.607	0.91
62_E	65_K	0.602	0.90
58_E	65_K	0.599	0.90
56_T	59_E	0.599	0.90
115_D	144_L	0.598	0.90
105_E	163_S	0.596	0.90
22_R	193_V	0.586	0.89
92_V	95_L	0.584	0.89
100_A	132_N	0.583	0.89
8_F	41_F	0.576	0.88
64_F	71_I	0.575	0.88
67_E	74_Y	0.573	0.88
107_Q	113_Y	0.572	0.88
39_K	108_R	0.567	0.87
13_C	16_C	0.566	0.87
5_I	27_V	0.566	0.87
7_F	36_V	0.566	0.87
138_I	151_F	0.564	0.87
52_A	56_T	0.564	0.87
110_D	146_L	0.564	0.87
48_E	51_K	0.563	0.87
109_G	159_K	0.562	0.87
65_K	68_F	0.560	0.87
102_K	161_R	0.559	0.87
60_A	63_I	0.558	0.87
102_K	160_A	0.554	0.86
64_F	67_E	0.554	0.86
92_V	132_N	0.553	0.86
185_N	206_L	0.549	0.86
110_D	147_D	0.548	0.86
41_F	176_I	0.547	0.86
199_L	203_I	0.544	0.85
154_D	157_S	0.538	0.85
95_L	130_N	0.536	0.84
21_R	85_G	0.536	0.84
58_E	64_F	0.536	0.84
97_P	124_F	0.535	0.84
47_L	51_K	0.534	0.84
184_V	203_I	0.532	0.84
65_K	69_S	0.532	0.84
77_D	82_K	0.532	0.84
12_L	124_F	0.531	0.84
95_L	124_F	0.531	0.84
68_F	71_I	0.530	0.84
122_E	143_E	0.528	0.83
168_E	172_H	0.527	0.83
89_I	92_V	0.527	0.83
3_I	185_N	0.527	0.83
12_L	95_L	0.522	0.83
19_T	193_V	0.521	0.83
172_H	177_R	0.520	0.83
107_Q	116_Y	0.519	0.82
151_F	154_D	0.518	0.82
114_W	118_D	0.517	0.82
174_M	186_D	0.513	0.82
3_I	27_V	0.513	0.82
78_Y	83_V	0.511	0.81
176_I	189_L	0.507	0.81
78_Y	82_K	0.507	0.81
184_V	206_L	0.507	0.81
45_S	101_C	0.506	0.81
53_A	61_K	0.506	0.81
166_E	169_A	0.505	0.81
31_K	207_L	0.505	0.81
146_L	151_F	0.505	0.81
129_E	143_E	0.505	0.81
15_F	22_R	0.504	0.81
11_V	92_V	0.502	0.80
34_V	203_I	0.502	0.80
55_P	69_S	0.501	0.80
22_R	25_K	0.500	0.80

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1r4wA	2	0.9156	100	0.328	Contact Map
2imfA	2	0.9022	100	0.331	Contact Map
3gl5A	2	0.9689	100	0.333	Contact Map
3rppA	2	0.8978	100	0.337	Contact Map
3fz5A	2	0.8311	100	0.338	Contact Map
3kzqA	3	0.88	100	0.359	Contact Map
2in3A	1	0.8533	100	0.399	Contact Map
4nxiA	2	0.8044	100	0.523	Contact Map
3c7mA	1	0.7644	100	0.527	Contact Map
3gmfA	1	0.7689	100	0.528	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0083 seconds.