Q97Z53 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97Z53 - Transcriptional regulator, marR family, putative

UniProt:	Q97Z53	Sequences: MMMKNFIVYKVRYLTMILATKYSEVWDLITGLTRKINKDTDKALEQIGLSYFEFKVMCALEEEGKVPMSRIAEKYMLTKAGLTSIIDRLEEKELVRRVRSESDRRVIYVELTEKGRERLMESRKIFLNVLSSFLSKLSEDEIRELERLFSKLFS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	154 (131)
Sequences:	22089 (16033)
Seq/√Len:	1400.8

ECOLI - MARR SLYA MPRA
BACSU - YFIV YETL YWAE YCGE YKOM YUSO YSMB MHQR YXAD YYBA OHRR YWOH YPOP YDCH YWHA YDGJ YDGG YHJH YVMB YVNA YBFA
SULSO - Q97Z53 Q97YG9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
98_V	110_E	3.127	1.00
141_E	151_K	2.943	1.00
65_K	110_E	2.884	1.00
96_R	110_E	2.676	1.00
67_P	106_V	2.562	1.00
138_S	141_E	2.508	1.00
100_S	108_Y	2.484	1.00
144_E	147_R	2.278	1.00
144_E	148_L	2.102	1.00
99_R	107_I	2.069	1.00
61_E	119_L	2.012	1.00
53_E	92_K	1.985	1.00
67_P	70_R	1.970	1.00
137_L	148_L	1.909	1.00
61_E	111_L	1.845	1.00
100_S	106_V	1.806	1.00
141_E	144_E	1.782	1.00
53_E	88_R	1.659	1.00
68_M	86_I	1.621	1.00
114_K	118_R	1.613	1.00
93_E	114_K	1.608	1.00
28_L	150_S	1.592	1.00
145_L	148_L	1.590	1.00
141_E	147_R	1.586	1.00
50_S	53_E	1.572	1.00
90_E	97_R	1.568	1.00
63_E	74_K	1.563	1.00
86_I	109_V	1.510	1.00
114_K	117_E	1.474	1.00
118_R	121_E	1.445	1.00
56_V	85_I	1.442	1.00
87_D	91_E	1.431	1.00
61_E	116_R	1.400	1.00
47_I	125_I	1.376	1.00
28_L	146_E	1.354	1.00
59_A	74_K	1.341	1.00
43_A	125_I	1.330	1.00
117_E	121_E	1.281	1.00
68_M	107_I	1.258	1.00
70_R	73_E	1.255	1.00
78_T	81_G	1.242	1.00
69_S	79_K	1.240	1.00
47_I	121_E	1.232	1.00
56_V	82_L	1.205	1.00
87_D	104_R	1.204	1.00
148_L	151_K	1.201	1.00
69_S	73_E	1.150	1.00
77_L	81_G	1.136	1.00
68_M	109_V	1.119	1.00
46_Q	125_I	1.101	1.00
65_K	108_Y	1.094	1.00
140_D	144_E	1.067	1.00
41_D	45_E	1.066	1.00
68_M	82_L	1.061	1.00
142_I	146_E	1.053	1.00
147_R	151_K	1.039	1.00
80_A	83_T	1.025	1.00
94_L	118_R	1.009	1.00
97_R	107_I	1.004	1.00
141_E	148_L	0.997	1.00
92_K	114_K	0.984	1.00
113_E	116_R	0.983	1.00
111_L	115_G	0.981	1.00
64_G	116_R	0.981	1.00
83_T	87_D	0.979	1.00
43_A	132_S	0.977	1.00
146_E	150_S	0.971	1.00
87_D	90_E	0.970	1.00
66_V	70_R	0.967	1.00
30_T	33_T	0.967	1.00
66_V	74_K	0.964	1.00
92_K	118_R	0.960	1.00
68_M	79_K	0.956	1.00
43_A	128_N	0.952	1.00
125_I	128_N	0.945	1.00
70_R	74_K	0.945	1.00
52_F	85_I	0.941	1.00
32_L	149_F	0.937	1.00
99_R	104_R	0.930	1.00
61_E	120_M	0.925	1.00
86_I	95_V	0.925	1.00
96_R	112_T	0.918	1.00
25_V	146_E	0.913	1.00
77_L	82_L	0.905	1.00
48_G	92_K	0.902	1.00
47_I	122_S	0.890	1.00
98_V	108_Y	0.890	1.00
65_K	98_V	0.887	1.00
113_E	117_E	0.886	1.00
116_R	120_M	0.884	1.00
81_G	84_S	0.883	1.00
33_T	37_N	0.876	1.00
94_L	114_K	0.872	1.00
60_L	95_V	0.871	1.00
63_E	66_V	0.867	1.00
55_K	75_Y	0.859	1.00
41_D	51_Y	0.859	1.00
130_L	133_F	0.848	1.00
137_L	152_L	0.846	1.00
78_T	84_S	0.838	1.00
124_K	128_N	0.837	1.00
54_F	122_S	0.835	1.00
129_V	132_S	0.830	1.00
139_E	143_R	0.827	1.00
43_A	129_V	0.827	1.00
57_M	119_L	0.825	1.00
90_E	96_R	0.817	1.00
126_F	130_L	0.813	1.00
63_E	70_R	0.811	1.00
121_E	125_I	0.810	1.00
128_N	132_S	0.808	1.00
100_S	103_D	0.793	1.00
101_E	108_Y	0.792	1.00
61_E	123_R	0.791	1.00
128_N	131_S	0.789	1.00
103_D	106_V	0.789	1.00
29_I	33_T	0.787	1.00
87_D	97_R	0.783	1.00
84_S	87_D	0.779	1.00
86_I	90_E	0.778	1.00
84_S	88_R	0.774	1.00
56_V	75_Y	0.764	1.00
111_L	116_R	0.763	1.00
39_D	129_V	0.758	1.00
43_A	46_Q	0.754	1.00
140_D	143_R	0.752	1.00
30_T	34_R	0.744	1.00
34_R	38_K	0.738	1.00
117_E	120_M	0.732	1.00
132_S	135_S	0.725	1.00
90_E	95_V	0.725	1.00
124_K	127_L	0.723	1.00
59_A	66_V	0.722	1.00
143_R	147_R	0.714	1.00
54_F	126_F	0.714	1.00
134_L	142_I	0.710	1.00
59_A	63_E	0.709	1.00
72_A	82_L	0.707	1.00
143_R	146_E	0.706	1.00
138_S	142_I	0.704	1.00
59_A	75_Y	0.704	1.00
127_L	131_S	0.701	1.00
64_G	110_E	0.696	1.00
56_V	71_I	0.690	1.00
32_L	152_L	0.688	1.00
68_M	83_T	0.687	1.00
52_F	81_G	0.684	1.00
60_L	66_V	0.678	1.00
88_R	91_E	0.660	1.00
28_L	31_G	0.659	1.00
58_C	62_E	0.654	1.00
29_I	32_L	0.652	1.00
144_E	151_K	0.650	1.00
39_D	132_S	0.646	1.00
72_A	79_K	0.644	1.00
121_E	124_K	0.635	1.00
112_T	115_G	0.634	1.00
59_A	71_I	0.631	1.00
60_L	111_L	0.630	1.00
138_S	151_K	0.626	1.00
37_N	40_T	0.620	1.00
88_R	92_K	0.619	1.00
137_L	142_I	0.616	1.00
54_F	119_L	0.614	1.00
31_G	35_K	0.613	1.00
39_D	42_K	0.611	1.00
82_L	86_I	0.610	1.00
89_L	94_L	0.609	1.00
37_N	41_D	0.603	1.00
57_M	61_E	0.598	1.00
40_T	43_A	0.591	1.00
40_T	126_F	0.589	1.00
29_I	149_F	0.583	1.00
55_K	59_A	0.580	1.00
93_E	96_R	0.579	1.00
53_E	85_I	0.578	1.00
120_M	124_K	0.562	1.00
134_L	138_S	0.550	1.00
68_M	106_V	0.549	1.00
120_M	123_R	0.547	1.00
123_R	127_L	0.539	1.00
42_K	45_E	0.533	1.00
71_I	109_V	0.530	1.00
58_C	123_R	0.526	1.00
67_P	100_S	0.520	1.00
24_E	146_E	0.519	1.00
38_K	42_K	0.519	1.00
49_L	118_R	0.518	1.00
119_L	123_R	0.518	1.00
49_L	122_S	0.517	1.00
136_K	151_K	0.513	1.00
69_S	72_A	0.510	1.00
137_L	151_K	0.507	1.00
148_L	152_L	0.504	1.00
30_T	51_Y	0.504	1.00
69_S	106_V	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2fbkA	2	0.9286	99.9	0.279	Contact Map
3e6mA	2	0.9481	99.9	0.296	Contact Map
3u2rA	4	0.8636	99.9	0.298	Contact Map
3deuA	2	0.8182	99.9	0.3	Contact Map
3cjnA	2	0.9026	99.9	0.302	Contact Map
4rguA	4	0.8831	99.9	0.304	Contact Map
3bj6A	2	0.9286	99.9	0.308	Contact Map
3zplA	2	0.9286	99.9	0.31	Contact Map
3boqA	2	0.8636	99.9	0.31	Contact Map
2ethA	4	0.8831	99.9	0.313	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.