Q97Z51 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97Z51 - Glutaconate CoA-transferase, subunit B (GctB)

UniProt:	Q97Z51	Sequences: MKSYNVDYVIKAISTLLEDGELVYIGLNSIPSLIASFMARDLYRKKIRIIGVAEASNPSRVVLSPSTGNPFFVEASPVMITADAFDLAQKGKLDVMFLGPAQIDEETNVNLTMIGNEYHNPKVKLPGGAATAFILPLSRKAILWNLKHSKRSLVRRVDFITGTAKFSNNKVFVVTNLGVLAYNREERKWYLEAIYPFSSYEKVVENTDFEVKRKDSERLIDLTDEDLRFINYMDPYNLRSALETL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	245 (201)
Sequences:	3431 (1584)
Seq/√Len:	111.7

ECOLI - ATOA YDIF
BACSU - SCOB YODR
HALSA - Q9HHP2
SULSO - Q97Z51

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
104_D	108_N	3.878	1.00
150_K	154_V	3.734	1.00
201_E	205_E	3.400	1.00
180_L	211_V	3.247	1.00
80_I	83_D	3.174	1.00
158_D	208_D	3.009	1.00
172_F	181_A	2.878	1.00
181_A	192_E	2.777	1.00
194_I	203_V	2.718	1.00
105_E	158_D	2.582	1.00
183_N	190_Y	2.575	1.00
214_K	217_E	2.546	1.00
194_I	200_Y	2.543	1.00
183_N	188_K	2.513	1.00
177_L	206_N	2.465	1.00
182_Y	189_W	2.380	1.00
12_A	193_A	2.335	1.00
200_Y	213_R	2.296	1.00
191_L	213_R	2.277	1.00
202_K	206_N	2.276	1.00
160_I	164_A	2.044	1.00
18_E	21_E	1.992	1.00
200_Y	204_V	1.987	1.00
13_I	144_W	1.960	1.00
184_R	188_K	1.951	1.00
202_K	205_E	1.943	1.00
199_S	202_K	1.900	1.00
183_N	187_R	1.873	1.00
191_L	200_Y	1.848	1.00
106_E	159_F	1.817	1.00
177_L	198_S	1.814	1.00
184_R	187_R	1.804	1.00
105_E	210_E	1.802	1.00
61_V	70_P	1.759	1.00
148_H	207_T	1.730	1.00
204_V	211_V	1.723	1.00
21_E	95_V	1.714	1.00
173_V	182_Y	1.685	1.00
188_K	212_K	1.659	1.00
50_I	88_A	1.653	1.00
7_D	38_M	1.648	1.00
204_V	210_E	1.646	1.00
13_I	97_F	1.633	1.00
190_Y	212_K	1.615	1.00
155_R	208_D	1.599	1.00
35_A	97_F	1.580	1.00
172_F	192_E	1.570	1.00
102_Q	158_D	1.563	1.00
190_Y	214_K	1.543	1.00
195_Y	198_S	1.540	1.00
173_V	189_W	1.530	1.00
13_I	174_V	1.522	1.00
9_V	144_W	1.505	1.00
158_D	210_E	1.486	1.00
89_Q	133_F	1.479	1.00
213_R	217_E	1.438	1.00
181_A	190_Y	1.436	1.00
100_P	146_L	1.409	1.00
153_L	156_R	1.378	1.00
66_S	70_P	1.367	1.00
102_Q	161_T	1.357	1.00
192_E	214_K	1.344	1.00
152_S	155_R	1.303	0.99
178_G	203_V	1.273	0.99
187_R	212_K	1.268	0.99
207_T	211_V	1.264	0.99
16_L	174_V	1.247	0.99
105_E	155_R	1.225	0.99
17_L	35_A	1.211	0.99
94_D	139_R	1.211	0.99
102_Q	162_G	1.202	0.99
16_L	172_F	1.185	0.99
149_S	206_N	1.185	0.99
100_P	109_V	1.173	0.99
95_V	142_I	1.172	0.99
55_A	58_P	1.162	0.99
201_E	204_V	1.154	0.99
194_I	198_S	1.152	0.99
51_G	55_A	1.131	0.98
31_P	144_W	1.104	0.98
19_D	45_K	1.101	0.98
194_I	217_E	1.098	0.98
148_H	177_L	1.093	0.98
6_V	147_K	1.088	0.98
142_I	174_V	1.080	0.98
17_L	23_V	1.062	0.98
5_N	8_Y	1.058	0.98
189_W	209_F	1.045	0.97
152_S	156_R	1.031	0.97
106_E	168_N	1.028	0.97
32_S	99_G	1.024	0.97
95_V	140_K	1.021	0.97
214_K	218_R	1.015	0.97
19_D	46_K	1.014	0.97
101_A	114_I	1.011	0.97
149_S	176_N	1.002	0.97
140_K	170_K	1.000	0.97
198_S	202_K	0.965	0.96
36_S	39_A	0.965	0.96
62_V	73_V	0.962	0.96
12_A	179_V	0.962	0.96
180_L	204_V	0.959	0.96
191_L	203_V	0.958	0.96
97_F	144_W	0.944	0.95
10_I	35_A	0.940	0.95
6_V	34_I	0.937	0.95
102_Q	157_V	0.935	0.95
179_V	193_A	0.933	0.95
198_S	203_V	0.921	0.95
191_L	211_V	0.918	0.95
158_D	209_F	0.916	0.95
177_L	202_K	0.899	0.94
140_K	172_F	0.895	0.94
39_A	49_I	0.891	0.94
8_Y	196_P	0.881	0.93
56_S	79_M	0.878	0.93
102_Q	155_R	0.875	0.93
102_Q	150_K	0.866	0.93
17_L	47_I	0.856	0.92
173_V	180_L	0.853	0.92
59_S	62_V	0.850	0.92
103_I	153_L	0.846	0.92
135_L	166_F	0.844	0.92
180_L	189_W	0.840	0.92
6_V	31_P	0.839	0.92
113_M	125_L	0.837	0.92
40_R	45_K	0.832	0.91
66_S	72_F	0.829	0.91
59_S	73_V	0.819	0.91
97_F	174_V	0.817	0.91
55_A	78_V	0.814	0.90
200_Y	217_E	0.811	0.90
177_L	203_V	0.810	0.90
11_K	15_T	0.809	0.90
42_L	46_K	0.807	0.90
187_R	190_Y	0.805	0.90
27_L	68_G	0.798	0.89
157_V	161_T	0.797	0.89
17_L	97_F	0.797	0.89
22_L	87_L	0.794	0.89
102_Q	154_V	0.793	0.89
215_D	218_R	0.793	0.89
87_L	93_L	0.792	0.89
183_N	212_K	0.791	0.89
144_W	174_V	0.788	0.89
55_A	72_F	0.785	0.89
204_V	213_R	0.777	0.88
194_I	199_S	0.774	0.88
200_Y	211_V	0.765	0.87
110_N	164_A	0.765	0.87
70_P	136_P	0.764	0.87
8_Y	11_K	0.764	0.87
27_L	53_A	0.762	0.87
52_V	85_F	0.759	0.87
150_K	155_R	0.759	0.87
66_S	69_N	0.755	0.87
13_I	35_A	0.754	0.87
105_E	209_F	0.753	0.87
11_K	38_M	0.750	0.86
175_T	178_G	0.746	0.86
13_I	142_I	0.744	0.86
166_F	169_N	0.741	0.86
36_S	61_V	0.724	0.84
79_M	84_A	0.717	0.84
178_G	194_I	0.710	0.83
54_E	129_A	0.710	0.83
55_A	76_S	0.709	0.83
32_S	53_A	0.709	0.83
157_V	208_D	0.707	0.83
17_L	95_V	0.704	0.83
108_N	164_A	0.702	0.83
27_L	33_L	0.699	0.82
108_N	168_N	0.698	0.82
61_V	71_F	0.693	0.82
16_L	140_K	0.689	0.81
177_L	207_T	0.686	0.81
100_P	103_I	0.685	0.81
136_P	166_F	0.685	0.81
31_P	147_K	0.684	0.81
194_I	197_F	0.684	0.81
154_V	208_D	0.684	0.81
182_Y	188_K	0.681	0.81
180_L	213_R	0.679	0.80
9_V	13_I	0.679	0.80
42_L	45_K	0.678	0.80
114_I	162_G	0.677	0.80
149_S	155_R	0.674	0.80
103_I	109_V	0.670	0.80
107_T	143_L	0.664	0.79
8_Y	195_Y	0.661	0.79
191_L	194_I	0.659	0.78
114_I	123_V	0.658	0.78
7_D	34_I	0.657	0.78
66_S	71_F	0.655	0.78
12_A	15_T	0.654	0.78
116_N	123_V	0.654	0.78
142_I	172_F	0.651	0.78
54_E	130_A	0.647	0.77
178_G	192_E	0.645	0.77
17_L	96_M	0.642	0.77
39_A	45_K	0.641	0.76
116_N	124_K	0.636	0.76
15_T	204_V	0.632	0.75
12_A	16_L	0.631	0.75
95_V	136_P	0.629	0.75
7_D	41_D	0.625	0.75
30_I	57_N	0.622	0.74
140_K	171_V	0.622	0.74
104_D	159_F	0.622	0.74
148_H	180_L	0.621	0.74
212_K	216_S	0.620	0.74
67_T	70_P	0.618	0.74
102_Q	152_S	0.615	0.74
106_E	165_K	0.614	0.73
164_A	167_S	0.614	0.73
52_V	131_T	0.609	0.73
187_R	214_K	0.607	0.73
14_S	38_M	0.603	0.72
18_E	45_K	0.601	0.72
39_A	125_L	0.601	0.72
96_M	134_I	0.599	0.72
8_Y	197_F	0.599	0.72
91_G	98_L	0.598	0.71
189_W	211_V	0.597	0.71
106_E	156_R	0.597	0.71
90_K	137_L	0.595	0.71
177_L	195_Y	0.593	0.71
10_I	31_P	0.592	0.71
67_T	73_V	0.591	0.71
22_L	56_S	0.589	0.70
102_Q	134_I	0.588	0.70
30_I	52_V	0.584	0.70
124_K	162_G	0.581	0.69
212_K	215_D	0.580	0.69
7_D	11_K	0.579	0.69
213_R	216_S	0.577	0.69
22_L	48_R	0.575	0.68
195_Y	203_V	0.575	0.68
149_S	154_V	0.574	0.68
49_I	60_R	0.574	0.68
16_L	142_I	0.567	0.67
12_A	192_E	0.565	0.67
128_G	161_T	0.565	0.67
30_I	129_A	0.565	0.67
81_T	115_G	0.564	0.67
19_D	40_R	0.563	0.67
96_M	138_S	0.561	0.67
10_I	38_M	0.561	0.67
165_K	170_K	0.558	0.66
14_S	91_G	0.556	0.66
39_A	95_V	0.556	0.66
212_K	217_E	0.555	0.66
158_D	161_T	0.553	0.65
65_P	72_F	0.553	0.65
15_T	18_E	0.552	0.65
71_F	126_P	0.551	0.65
31_P	34_I	0.549	0.65
21_E	140_K	0.548	0.65
183_N	214_K	0.546	0.65
109_V	135_L	0.544	0.64
107_T	173_V	0.542	0.64
27_L	99_G	0.539	0.64
16_L	179_V	0.538	0.63
113_M	124_K	0.536	0.63
55_A	75_A	0.536	0.63
127_G	174_V	0.536	0.63
204_V	212_K	0.532	0.63
135_L	169_N	0.530	0.62
105_E	188_K	0.529	0.62
13_I	136_P	0.527	0.62
67_T	72_F	0.525	0.62
114_I	124_K	0.522	0.61
173_V	178_G	0.521	0.61
178_G	191_L	0.521	0.61
127_G	142_I	0.519	0.61
128_G	132_A	0.517	0.60
114_I	127_G	0.517	0.60
41_D	139_R	0.516	0.60
131_T	143_L	0.515	0.60
19_D	42_L	0.514	0.60
148_H	209_F	0.514	0.60
170_K	181_A	0.512	0.60
198_S	206_N	0.512	0.60
205_E	216_S	0.512	0.60
35_A	39_A	0.510	0.59
52_V	129_A	0.510	0.59
65_P	68_G	0.509	0.59
150_K	153_L	0.509	0.59
16_L	96_M	0.509	0.59
31_P	191_L	0.508	0.59
201_E	210_E	0.508	0.59
115_G	142_I	0.507	0.59
37_F	61_V	0.507	0.59
69_N	73_V	0.505	0.59
41_D	159_F	0.504	0.58
184_R	190_Y	0.504	0.58
162_G	171_V	0.502	0.58
15_T	46_K	0.502	0.58
85_F	89_Q	0.501	0.58
128_G	162_G	0.500	0.58
55_A	65_P	0.500	0.58
64_S	68_G	0.500	0.58

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1poiB	1	0.9714	100	0.244	Contact Map
2ahuA	3	0.8857	100	0.446	Contact Map
3k6mA	2	0.8531	100	0.484	Contact Map
4kgbA	2	0.8449	100	0.484	Contact Map
1xr4A	2	0.902	100	0.536	Contact Map
2hj0A	2	0.8816	100	0.574	Contact Map
3gk7A	2	0.8571	100	0.607	Contact Map
3rrlB	1	0.7918	100	0.612	Contact Map
3eh7A	2	0.8286	100	0.625	Contact Map
3d3uA	1	0.7429	100	0.627	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0078 seconds.