GCSH3 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GCSH3 - Probable glycine cleavage system H protein 3

UniProt:	Q97Z34	Sequences: MKILGFTFPDDLLYEPEKHVWVRIEDNSVVSIGVTDLGQYMAGKIFQVTAKQKGEKVNGRSVLFSIESAKWIGKFRLPIEGEVFDVNEEVVKNPSIINERPYDSWIVKIRVEDMDIIKRTFKPIQEVYKQFEEEAKRVVR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	140 (122)
Sequences:	3741 (2336)
Seq/√Len:	211.5

ECOLI - GCSH
BACSU - GCSH
HALSA - GCSH
SULSO - GCSH3 GCSH2 GCSH1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
123_P	126_E	4.162	1.00
82_E	110_R	3.500	1.00
63_L	107_V	3.088	1.00
31_S	108_K	2.905	1.00
85_D	108_K	2.737	1.00
100_R	103_D	2.632	1.00
36_D	39_Q	2.197	1.00
24_I	30_V	2.021	1.00
30_V	111_V	2.012	1.00
29_V	108_K	1.986	1.00
56_K	112_E	1.950	1.00
56_K	82_E	1.900	1.00
122_K	130_Q	1.895	1.00
57_V	77_L	1.843	1.00
113_D	116_I	1.824	1.00
115_D	118_K	1.805	1.00
80_E	116_I	1.795	1.00
23_R	31_S	1.745	1.00
124_I	128_Y	1.720	1.00
12_L	23_R	1.707	1.00
93_N	96_I	1.697	1.00
15_E	18_K	1.621	1.00
59_G	120_T	1.592	1.00
12_L	102_Y	1.585	1.00
11_D	23_R	1.584	1.00
97_I	106_I	1.583	1.00
27_N	110_R	1.543	1.00
79_I	111_V	1.508	1.00
58_N	61_S	1.493	1.00
64_F	75_F	1.474	1.00
52_Q	55_E	1.430	1.00
96_I	104_S	1.429	1.00
36_D	40_Y	1.427	1.00
65_S	72_I	1.409	1.00
89_E	93_N	1.370	1.00
62_V	74_K	1.345	1.00
17_E	130_Q	1.337	1.00
54_G	82_E	1.325	1.00
58_N	80_E	1.315	1.00
29_V	110_R	1.309	1.00
63_L	75_F	1.284	1.00
90_V	106_I	1.282	1.00
22_V	30_V	1.276	1.00
50_A	86_V	1.249	1.00
39_Q	98_N	1.246	1.00
89_E	96_I	1.183	1.00
37_L	41_M	1.169	1.00
24_I	111_V	1.164	1.00
25_E	31_S	1.154	1.00
57_V	63_L	1.140	1.00
65_S	69_A	1.137	1.00
88_E	91_V	1.124	1.00
81_G	109_I	1.117	1.00
29_V	84_F	1.102	1.00
10_D	125_Q	1.082	1.00
20_V	69_A	1.066	1.00
49_T	65_S	1.062	1.00
93_N	99_E	1.061	1.00
32_I	107_V	1.056	1.00
126_E	129_K	1.046	1.00
53_K	86_V	1.036	1.00
48_V	90_V	1.031	1.00
84_F	110_R	1.030	1.00
46_F	69_A	1.011	1.00
79_I	109_I	0.942	0.99
125_Q	128_Y	0.937	0.99
85_D	88_E	0.928	0.99
50_A	106_I	0.927	0.99
25_E	108_K	0.923	0.99
22_V	79_I	0.920	0.99
96_I	99_E	0.919	0.99
55_E	61_S	0.918	0.99
111_V	114_M	0.896	0.99
15_E	22_V	0.893	0.99
13_L	118_K	0.886	0.99
15_E	35_T	0.880	0.99
59_G	116_I	0.876	0.99
8_F	124_I	0.868	0.99
114_M	117_I	0.865	0.99
25_E	29_V	0.863	0.99
89_E	92_K	0.857	0.99
15_E	20_V	0.854	0.99
30_V	79_I	0.846	0.99
24_I	117_I	0.844	0.99
75_F	107_V	0.841	0.99
34_V	66_I	0.841	0.99
48_V	66_I	0.836	0.99
10_D	128_Y	0.826	0.99
80_E	112_E	0.825	0.99
21_W	33_G	0.817	0.99
8_F	128_Y	0.808	0.98
46_F	72_I	0.807	0.98
77_L	109_I	0.806	0.98
18_K	76_R	0.787	0.98
113_D	117_I	0.785	0.98
14_Y	102_Y	0.778	0.98
13_L	117_I	0.774	0.98
13_L	123_P	0.764	0.98
90_V	96_I	0.763	0.98
44_K	95_S	0.762	0.98
36_D	102_Y	0.757	0.98
31_S	104_S	0.756	0.98
102_Y	124_I	0.750	0.97
65_S	74_K	0.750	0.97
89_E	103_D	0.749	0.97
95_S	99_E	0.741	0.97
18_K	71_W	0.734	0.97
88_E	92_K	0.734	0.97
53_K	85_D	0.731	0.97
32_I	109_I	0.726	0.97
19_H	43_G	0.717	0.97
8_F	131_F	0.713	0.97
8_F	102_Y	0.712	0.96
45_I	66_I	0.694	0.96
39_Q	102_Y	0.691	0.96
112_E	116_I	0.689	0.96
57_V	80_E	0.680	0.95
42_A	73_G	0.678	0.95
57_V	83_V	0.674	0.95
68_S	71_W	0.671	0.95
51_K	86_V	0.670	0.95
51_K	68_S	0.670	0.95
24_I	114_M	0.668	0.95
122_K	126_E	0.667	0.95
29_V	85_D	0.665	0.95
9_P	124_I	0.656	0.94
67_E	70_K	0.655	0.94
125_Q	129_K	0.654	0.94
75_F	106_I	0.647	0.94
14_Y	35_T	0.647	0.94
100_R	104_S	0.646	0.94
45_I	64_F	0.634	0.93
70_K	73_G	0.633	0.93
18_K	60_R	0.624	0.93
26_D	29_V	0.624	0.93
36_D	98_N	0.622	0.93
9_P	35_T	0.619	0.93
20_V	46_F	0.615	0.92
17_E	126_E	0.612	0.92
114_M	118_K	0.612	0.92
29_V	111_V	0.612	0.92
52_Q	92_K	0.603	0.92
46_F	67_E	0.601	0.91
53_K	88_E	0.591	0.91
51_K	83_V	0.588	0.91
41_M	73_G	0.575	0.90
20_V	76_R	0.572	0.89
54_G	84_F	0.572	0.89
13_L	24_I	0.570	0.89
23_R	26_D	0.563	0.89
37_L	131_F	0.563	0.89
35_T	101_P	0.562	0.89
38_G	73_G	0.558	0.88
48_V	94_P	0.557	0.88
42_A	71_W	0.552	0.88
20_V	71_W	0.550	0.87
64_F	107_V	0.549	0.87
30_V	117_I	0.545	0.87
42_A	127_V	0.545	0.87
45_I	65_S	0.542	0.87
11_D	124_I	0.534	0.86
41_M	68_S	0.531	0.86
55_E	58_N	0.529	0.85
8_F	36_D	0.529	0.85
83_V	107_V	0.526	0.85
32_I	78_P	0.524	0.85
17_E	120_T	0.523	0.85
62_V	65_S	0.521	0.85
47_Q	73_G	0.519	0.84
48_V	96_I	0.517	0.84
45_I	63_L	0.516	0.84
20_V	38_G	0.515	0.84
14_Y	124_I	0.515	0.84
62_V	71_W	0.515	0.84
9_P	14_Y	0.512	0.84
45_I	98_N	0.509	0.83
66_I	106_I	0.509	0.83
44_K	47_Q	0.508	0.83
7_T	100_R	0.508	0.83
20_V	32_I	0.506	0.83
34_V	38_G	0.506	0.83
62_V	91_V	0.504	0.83
55_E	92_K	0.500	0.82

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3hgbA	1	0.9	100	0.205	Contact Map
3mxuA	3	0.9143	100	0.233	Contact Map
3tzuA	2	0.8643	100	0.274	Contact Map
3a7lA	1	0.9071	100	0.278	Contact Map
1hpcA	2	0.9286	100	0.282	Contact Map
3wdnA	1	0.8857	100	0.304	Contact Map
1onlA	1	0.9	100	0.324	Contact Map
1zkoA	2	0.8929	100	0.355	Contact Map
5a35A	1	0.7929	100	0.393	Contact Map
3u9tA	3	0.2143	97	0.847	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.