Q97Z29 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97Z29 - Uncharacterized protein

UniProt:	Q97Z29	Sequences: MENEEEVIKEVLLKYKNIATVGFSKDPSKAAFQVPKFLMDHGYNVIPVNPSASEILGKKSYPSILDVPDKVEIVEIFRPSNEVPKIVDQVLERVKKVGDVKVIWMQEGIRNDEAAEKARKAGLVVIQDRCMYKEYMKKIFNVNNPPPVSSLKNS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	154 (128)
Sequences:	2257 (1597)
Seq/√Len:	141.1

ECOLI - YCCU PKA
BACSU - YNET
HALSA - Q9HRP2
SULSO - Q97Z29 Q97XD9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
63_S	66_D	3.662	1.00
88_D	117_K	3.135	1.00
67_V	71_V	2.395	1.00
39_M	58_K	2.389	1.00
116_E	120_K	2.324	1.00
62_P	66_D	2.262	1.00
44_N	58_K	2.260	1.00
17_N	44_N	2.235	1.00
65_L	92_E	2.211	1.00
37_F	135_Y	2.195	1.00
65_L	89_Q	2.158	1.00
15_Y	73_I	2.126	1.00
36_K	40_D	2.042	1.00
97_V	100_V	1.973	1.00
61_Y	68_P	1.940	1.00
84_P	111_N	1.925	1.00
87_V	103_I	1.852	1.00
23_F	35_P	1.829	1.00
107_E	133_K	1.809	1.00
26_D	29_K	1.805	1.00
48_V	67_V	1.802	1.00
44_N	69_D	1.720	1.00
9_K	13_L	1.687	1.00
91_L	121_A	1.646	1.00
10_E	14_K	1.555	1.00
17_N	69_D	1.496	1.00
46_I	69_D	1.477	1.00
115_A	127_Q	1.472	1.00
70_K	101_K	1.472	1.00
87_V	114_A	1.462	1.00
134_E	137_K	1.441	1.00
83_V	105_M	1.416	1.00
85_K	88_D	1.407	1.00
91_L	117_K	1.369	1.00
84_P	117_K	1.355	1.00
11_V	102_V	1.353	1.00
25_K	52_A	1.348	1.00
55_I	60_S	1.336	1.00
54_E	59_K	1.303	1.00
64_I	97_V	1.252	1.00
115_A	119_R	1.240	1.00
15_Y	102_V	1.230	1.00
110_R	128_D	1.230	1.00
129_R	134_E	1.230	1.00
17_N	46_I	1.217	1.00
76_I	105_M	1.199	1.00
78_R	82_E	1.195	1.00
88_D	92_E	1.175	1.00
82_E	85_K	1.162	0.99
102_V	124_V	1.153	0.99
52_A	55_I	1.148	0.99
79_P	82_E	1.122	0.99
117_K	121_A	1.118	0.99
63_S	89_Q	1.117	0.99
52_A	60_S	1.117	0.99
112_D	127_Q	1.112	0.99
87_V	118_A	1.111	0.99
41_H	135_Y	1.098	0.99
20_T	45_V	1.097	0.99
112_D	116_E	1.084	0.99
84_P	88_D	1.067	0.99
116_E	119_R	1.061	0.99
33_Q	132_Y	1.056	0.99
115_A	125_V	1.041	0.99
73_I	131_M	1.024	0.99
18_I	73_I	1.018	0.99
21_V	74_V	1.008	0.99
53_S	62_P	1.004	0.99
71_V	97_V	0.992	0.98
15_Y	72_E	0.988	0.98
132_Y	136_M	0.988	0.98
77_F	106_Q	0.984	0.98
39_M	56_L	0.976	0.98
20_T	35_P	0.975	0.98
91_L	123_L	0.965	0.98
21_V	86_I	0.965	0.98
110_R	127_Q	0.959	0.98
73_I	102_V	0.952	0.98
23_F	55_I	0.938	0.98
118_A	125_V	0.933	0.98
32_F	36_K	0.932	0.98
107_E	134_E	0.926	0.97
24_S	31_A	0.925	0.97
29_K	79_P	0.923	0.97
30_A	34_V	0.916	0.97
30_A	33_Q	0.906	0.97
103_I	118_A	0.890	0.97
83_V	109_I	0.889	0.97
75_E	131_M	0.878	0.97
47_P	60_S	0.874	0.96
84_P	113_E	0.873	0.96
32_F	56_L	0.869	0.96
85_K	89_Q	0.868	0.96
118_A	123_L	0.860	0.96
37_F	132_Y	0.859	0.96
7_V	124_V	0.857	0.96
87_V	117_K	0.856	0.96
28_S	33_Q	0.840	0.96
10_E	124_V	0.831	0.95
11_V	126_I	0.827	0.95
47_P	59_K	0.822	0.95
46_I	67_V	0.810	0.95
21_V	90_V	0.809	0.95
61_Y	67_V	0.801	0.94
76_I	86_I	0.780	0.93
38_L	45_V	0.776	0.93
100_V	123_L	0.771	0.93
54_E	57_G	0.764	0.93
25_K	55_I	0.763	0.93
113_E	116_E	0.752	0.92
49_N	52_A	0.751	0.92
76_I	103_I	0.748	0.92
91_L	100_V	0.747	0.92
98_G	123_L	0.746	0.92
34_V	77_F	0.742	0.92
26_D	51_S	0.721	0.90
76_I	83_V	0.721	0.90
74_V	90_V	0.714	0.90
18_I	131_M	0.706	0.89
33_Q	36_K	0.704	0.89
35_P	58_K	0.697	0.89
25_K	51_S	0.694	0.89
18_I	43_Y	0.691	0.88
34_V	106_Q	0.672	0.87
8_I	129_R	0.670	0.87
8_I	12_L	0.666	0.87
90_V	123_L	0.665	0.86
10_E	13_L	0.658	0.86
37_F	136_M	0.656	0.86
83_V	111_N	0.654	0.86
27_P	32_F	0.653	0.85
49_N	60_S	0.651	0.85
49_N	62_P	0.649	0.85
111_N	114_A	0.642	0.84
112_D	115_A	0.641	0.84
31_A	35_P	0.640	0.84
105_M	125_V	0.631	0.83
35_P	45_V	0.629	0.83
107_E	132_Y	0.626	0.83
27_P	36_K	0.626	0.83
46_I	61_Y	0.623	0.83
88_D	113_E	0.622	0.83
35_P	38_L	0.618	0.82
24_S	52_A	0.613	0.82
53_S	59_K	0.610	0.81
111_N	117_K	0.609	0.81
23_F	45_V	0.609	0.81
37_F	41_H	0.608	0.81
39_M	44_N	0.608	0.81
67_V	97_V	0.607	0.81
104_W	114_A	0.603	0.81
90_V	100_V	0.601	0.80
54_E	60_S	0.600	0.80
49_N	79_P	0.593	0.80
14_K	101_K	0.593	0.80
101_K	124_V	0.592	0.79
24_S	86_I	0.589	0.79
35_P	39_M	0.589	0.79
78_R	86_I	0.585	0.79
106_Q	109_I	0.583	0.78
9_K	138_K	0.581	0.78
80_S	109_I	0.581	0.78
91_L	98_G	0.580	0.78
88_D	91_L	0.578	0.78
33_Q	37_F	0.566	0.76
7_V	14_K	0.565	0.76
34_V	75_E	0.560	0.76
25_K	49_N	0.558	0.75
29_K	109_I	0.556	0.75
87_V	91_L	0.556	0.75
23_F	60_S	0.548	0.74
6_E	9_K	0.548	0.74
75_E	106_Q	0.542	0.73
86_I	89_Q	0.541	0.73
6_E	10_E	0.539	0.73
52_A	62_P	0.531	0.72
20_T	23_F	0.527	0.71
88_D	120_K	0.527	0.71
70_K	97_V	0.525	0.71
45_V	58_K	0.521	0.70
7_V	10_E	0.520	0.70
23_F	39_M	0.518	0.70
30_A	77_F	0.518	0.70
64_I	90_V	0.516	0.70
38_L	131_M	0.513	0.69
24_S	49_N	0.511	0.69
39_M	45_V	0.509	0.69
69_D	97_V	0.504	0.68
35_P	56_L	0.500	0.67
80_S	110_R	0.500	0.67
72_E	101_K	0.500	0.67
19_A	71_V	0.500	0.67

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ff4A	1	0.7857	100	0.423	Contact Map
2csuA	2	0.9156	100	0.44	Contact Map
1iukA	1	0.8701	99.9	0.526	Contact Map
2duwA	1	0.8766	99.9	0.534	Contact Map
1y81A	1	0.7532	99.9	0.553	Contact Map
2d59A	1	0.8896	99.9	0.563	Contact Map
3pffA	2	0.8831	99.9	0.567	Contact Map
3mwdB	1	0.8896	99.8	0.602	Contact Map
2fp4A	1	0.9416	99.8	0.604	Contact Map
2yv1A	1	0.8896	99.8	0.613	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.