Q97Z18 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97Z18 - Uncharacterized protein

UniProt:	Q97Z18	Sequences: MAQAQTQGQEEEQKKKILIVVTHGPEDLDRTYAPLFMASISASMEYETSVFFMIKGPKLLDKKWQEEERKKGGNPFIHFFDMAKENGVKMYVCVQSLKDMCHMKEDDVVEGIELVGGSTLIDLTLEADRTLFF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	133 (114)
Sequences:	876 (426)
Seq/√Len:	39.9

BACSU - YRKE
HALSA - O54564
SULSO - Q97Z18 Q97Z17 Q97VJ2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
89_K	113_E	4.171	1.00
31_T	59_L	3.480	1.00
21_V	50_V	3.319	1.00
120_L	130_T	3.299	1.00
94_V	114_L	3.144	1.00
40_I	117_G	2.890	1.00
47_E	89_K	2.742	1.00
83_A	88_V	2.679	1.00
16_K	47_E	2.498	1.00
35_L	52_F	2.284	1.00
74_N	78_H	2.269	1.00
42_A	88_V	2.253	1.00
21_V	34_P	2.240	1.00
39_S	86_N	2.164	0.99
46_Y	125_L	2.155	0.99
23_H	30_R	2.021	0.99
35_L	50_V	1.950	0.99
124_T	129_R	1.891	0.98
35_L	80_F	1.829	0.98
52_F	60_L	1.784	0.98
81_D	85_E	1.685	0.97
91_Y	115_V	1.603	0.95
39_S	83_A	1.574	0.95
49_S	91_Y	1.560	0.95
84_K	111_G	1.450	0.92
17_I	46_Y	1.448	0.92
84_K	113_E	1.414	0.91
120_L	124_T	1.371	0.90
18_L	120_L	1.309	0.88
15_K	128_D	1.305	0.87
89_K	123_L	1.273	0.86
15_K	46_Y	1.251	0.85
103_M	108_V	1.246	0.85
97_L	108_V	1.246	0.85
120_L	129_R	1.220	0.84
78_H	82_M	1.201	0.83
42_A	83_A	1.191	0.82
29_D	55_K	1.181	0.82
73_G	95_Q	1.180	0.82
39_S	79_F	1.178	0.81
18_L	127_A	1.143	0.79
96_S	100_M	1.098	0.77
61_D	107_D	1.091	0.76
36_F	79_F	1.079	0.75
17_I	129_R	1.077	0.75
94_V	116_G	1.057	0.74
116_G	119_T	1.056	0.74
49_S	123_L	1.054	0.74
16_K	123_L	1.043	0.73
50_V	90_M	1.043	0.73
16_K	126_E	1.037	0.72
37_M	121_I	1.037	0.72
62_K	110_E	1.029	0.72
63_K	85_E	1.024	0.71
18_L	130_T	1.003	0.70
17_I	37_M	0.990	0.69
21_V	37_M	0.980	0.68
49_S	89_K	0.976	0.68
94_V	99_D	0.975	0.68
24_G	36_F	0.963	0.67
49_S	125_L	0.961	0.66
42_A	118_S	0.961	0.66
19_I	37_M	0.956	0.66
34_P	50_V	0.935	0.64
81_D	84_K	0.933	0.64
63_K	66_E	0.923	0.63
77_I	81_D	0.905	0.62
22_T	33_A	0.877	0.59
73_G	100_M	0.869	0.59
35_L	76_F	0.867	0.58
71_K	100_M	0.862	0.58
105_E	111_G	0.855	0.57
22_T	32_Y	0.851	0.57
46_Y	128_D	0.850	0.57
30_R	55_K	0.833	0.55
90_M	112_I	0.824	0.55
37_M	117_G	0.820	0.54
16_K	74_N	0.790	0.51
96_S	101_C	0.788	0.51
19_I	121_I	0.784	0.51
52_F	96_S	0.767	0.49
57_P	101_C	0.766	0.49
74_N	82_M	0.764	0.49
42_A	129_R	0.743	0.47
97_L	115_V	0.741	0.47
22_T	30_R	0.736	0.47
57_P	99_D	0.727	0.46
104_K	107_D	0.718	0.45
41_S	74_N	0.714	0.45
81_D	110_E	0.711	0.44
60_L	109_V	0.711	0.44
63_K	105_E	0.709	0.44
37_M	46_Y	0.707	0.44
66_E	77_I	0.694	0.43
39_S	88_V	0.694	0.43
61_D	103_M	0.686	0.42
55_K	101_C	0.684	0.42
33_A	117_G	0.684	0.42
57_P	92_V	0.683	0.42
68_E	117_G	0.678	0.41
67_E	105_E	0.674	0.41
30_R	33_A	0.674	0.41
59_L	90_M	0.669	0.41
65_Q	90_M	0.668	0.40
57_P	96_S	0.665	0.40
66_E	81_D	0.661	0.40
33_A	36_F	0.652	0.39
45_E	126_E	0.644	0.38
44_M	123_L	0.642	0.38
35_L	59_L	0.631	0.37
29_D	54_I	0.620	0.36
32_Y	68_E	0.616	0.36
19_I	34_P	0.616	0.36
20_V	53_M	0.614	0.36
17_I	125_L	0.614	0.36
22_T	55_K	0.611	0.36
80_F	94_V	0.611	0.36
62_K	70_K	0.609	0.35
125_L	128_D	0.608	0.35
91_Y	113_E	0.606	0.35
75_P	78_H	0.602	0.35
22_T	117_G	0.598	0.34
106_D	114_L	0.595	0.34
69_R	72_G	0.594	0.34
14_K	43_S	0.593	0.34
15_K	90_M	0.584	0.33
118_S	122_D	0.579	0.33
37_M	112_I	0.579	0.33
14_K	126_E	0.574	0.32
100_M	114_L	0.573	0.32
23_H	32_Y	0.573	0.32
18_L	123_L	0.572	0.32
35_L	109_V	0.572	0.32
87_G	101_C	0.572	0.32
49_S	120_L	0.571	0.32
20_V	37_M	0.569	0.32
43_S	116_G	0.568	0.32
15_K	70_K	0.567	0.32
17_I	78_H	0.565	0.32
42_A	47_E	0.564	0.32
57_P	100_M	0.562	0.32
28_L	32_Y	0.559	0.31
59_L	64_W	0.556	0.31
14_K	122_D	0.554	0.31
51_F	54_I	0.551	0.31
105_E	112_I	0.550	0.31
79_F	111_G	0.543	0.30
52_F	101_C	0.537	0.30
81_D	105_E	0.533	0.29
67_E	70_K	0.532	0.29
33_A	96_S	0.528	0.29
59_L	123_L	0.525	0.29
36_F	117_G	0.524	0.29
115_V	119_T	0.522	0.28
23_H	33_A	0.521	0.28
127_A	130_T	0.520	0.28
67_E	89_K	0.518	0.28
67_E	81_D	0.517	0.28
36_F	96_S	0.517	0.28
42_A	48_T	0.516	0.28
45_E	55_K	0.512	0.28
17_I	87_G	0.511	0.28
69_R	113_E	0.511	0.28
59_L	84_K	0.511	0.28
120_L	123_L	0.510	0.28
94_V	105_E	0.509	0.27
78_H	118_S	0.508	0.27
20_V	62_K	0.507	0.27
84_K	90_M	0.502	0.27
119_T	123_L	0.501	0.27
78_H	124_T	0.500	0.27

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3pnxA	4	0.9023	100	0.323	Contact Map
2qs7A	3	0.8722	100	0.356	Contact Map
3mc3A	3	0.812	99.9	0.456	Contact Map
1jx7A	5	0.8647	99.8	0.556	Contact Map
2hy5B	1	0.8797	99.8	0.567	Contact Map
2hy5A	2	0.8647	99.7	0.604	Contact Map
2d1pB	1	0.8797	99.7	0.604	Contact Map
2d1pA	2	0.8797	99.6	0.622	Contact Map
1l1sA	3	0.8045	99.5	0.648	Contact Map
2fb6A	3	0.8421	99.4	0.669	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.