Q97Z17 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97Z17 - Uncharacterized protein

UniProt:	Q97Z17	Sequences: MAEEKKKKLSIIVFSGTIDKLMPVGILTSGAAASGYEVNLFFTFWGLQAITKRSLNSQQPPQIDKNYEQMGPIMMQKMQEMKYPMWHQLVQQAKEIGEVKVFACSTTMEFFGIKREDLAEFVDDVVGVATFLDRAEGGTTLFI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	143 (135)
Sequences:	713 (370)
Seq/√Len:	31.8

BACSU - YRKE
HALSA - O54564
SULSO - Q97Z17 Q97VJ2 Q97Z18

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
100_K	123_D	4.781	1.00
131_F	140_T	3.942	1.00
13_V	40_L	3.920	1.00
21_L	49_A	3.798	1.00
30_G	128_V	3.703	1.00
105_S	125_V	3.675	1.00
77_K	80_E	2.924	1.00
32_A	99_V	2.504	1.00
37_E	100_K	2.405	0.99
8_K	37_E	2.374	0.99
135_A	139_T	2.354	0.99
29_S	96_I	2.274	0.99
15_S	20_K	2.131	0.98
84_P	88_Q	2.096	0.98
25_G	42_F	1.950	0.97
22_M	75_M	1.865	0.96
102_F	126_V	1.827	0.96
93_A	99_V	1.811	0.96
25_G	40_L	1.763	0.95
25_G	90_V	1.756	0.95
13_V	24_V	1.723	0.94
10_S	131_F	1.720	0.94
39_N	102_F	1.668	0.93
108_M	118_L	1.663	0.93
91_Q	95_E	1.660	0.93
61_P	72_P	1.631	0.92
131_F	139_T	1.624	0.92
40_L	101_V	1.597	0.91
131_F	135_A	1.564	0.91
113_I	118_L	1.528	0.90
42_F	50_I	1.516	0.89
29_S	93_A	1.501	0.89
27_L	128_V	1.500	0.89
122_V	125_V	1.491	0.88
9_L	36_Y	1.408	0.85
83_Y	106_T	1.401	0.85
73_I	76_Q	1.364	0.83
72_P	76_Q	1.342	0.82
100_K	134_R	1.336	0.82
72_P	75_M	1.324	0.81
7_K	36_Y	1.307	0.81
36_Y	138_G	1.294	0.80
27_L	132_L	1.276	0.79
14_F	19_D	1.234	0.77
11_I	143_I	1.224	0.76
32_A	129_A	1.195	0.74
29_S	89_L	1.188	0.74
94_K	121_F	1.177	0.73
47_L	103_A	1.162	0.72
9_L	27_L	1.157	0.72
8_K	136_E	1.149	0.71
11_I	27_L	1.146	0.71
61_P	65_K	1.131	0.70
26_I	89_L	1.130	0.70
88_Q	92_Q	1.108	0.68
12_I	27_L	1.078	0.66
10_S	140_T	1.078	0.66
94_K	123_D	1.077	0.66
107_T	110_F	1.010	0.61
26_I	75_M	1.007	0.61
67_Y	72_P	1.006	0.61
110_F	125_V	0.976	0.58
36_Y	139_T	0.963	0.57
39_N	100_K	0.958	0.57
13_V	42_F	0.953	0.57
18_I	76_Q	0.939	0.55
75_M	110_F	0.937	0.55
85_M	88_Q	0.931	0.55
128_V	138_G	0.909	0.53
39_N	131_F	0.909	0.53
14_F	23_P	0.894	0.52
61_P	64_D	0.882	0.51
20_K	45_W	0.875	0.50
53_R	95_E	0.874	0.50
8_K	134_R	0.854	0.48
14_F	20_K	0.850	0.48
50_I	119_A	0.848	0.48
127_G	130_T	0.847	0.48
105_S	127_G	0.847	0.48
66_N	72_P	0.843	0.48
39_N	134_R	0.826	0.46
61_P	122_V	0.823	0.46
84_P	92_Q	0.819	0.46
59_Q	115_R	0.815	0.45
52_K	80_E	0.815	0.45
12_I	52_K	0.810	0.45
52_K	120_E	0.801	0.44
7_K	138_G	0.785	0.43
51_T	113_I	0.776	0.42
65_K	86_W	0.776	0.42
66_N	71_G	0.774	0.42
12_I	43_T	0.767	0.41
97_G	111_F	0.766	0.41
47_L	111_F	0.762	0.41
19_D	45_W	0.754	0.40
30_G	129_A	0.751	0.40
51_T	143_I	0.751	0.40
9_L	139_T	0.749	0.40
47_L	109_E	0.747	0.40
16_G	26_I	0.739	0.39
56_N	59_Q	0.735	0.39
29_S	92_Q	0.734	0.39
16_G	19_D	0.732	0.39
27_L	36_Y	0.731	0.39
102_F	135_A	0.727	0.38
72_P	90_V	0.721	0.38
34_S	134_R	0.717	0.38
70_M	80_E	0.709	0.37
18_I	67_Y	0.699	0.36
91_Q	96_I	0.699	0.36
10_S	138_G	0.697	0.36
88_Q	135_A	0.692	0.36
91_Q	116_E	0.691	0.36
17_T	66_N	0.685	0.35
96_I	130_T	0.682	0.35
22_M	89_L	0.679	0.35
34_S	40_L	0.677	0.35
91_Q	94_K	0.670	0.34
102_F	134_R	0.670	0.34
82_K	106_T	0.668	0.34
32_A	93_A	0.666	0.34
8_K	84_P	0.666	0.34
65_K	69_Q	0.662	0.33
47_L	108_M	0.658	0.33
33_A	127_G	0.653	0.33
105_S	109_E	0.649	0.32
68_E	72_P	0.648	0.32
70_M	73_I	0.645	0.32
54_S	111_F	0.637	0.32
102_F	130_T	0.637	0.32
76_Q	85_M	0.636	0.32
40_L	90_V	0.634	0.31
14_F	43_T	0.634	0.31
17_T	63_I	0.629	0.31
44_F	107_T	0.628	0.31
21_L	86_W	0.626	0.31
9_L	138_G	0.623	0.31
54_S	58_Q	0.622	0.31
37_E	126_V	0.619	0.30
32_A	96_I	0.618	0.30
17_T	45_W	0.617	0.30
7_K	80_E	0.613	0.30
102_F	132_L	0.606	0.29
28_T	43_T	0.602	0.29
49_A	101_V	0.598	0.29
13_V	27_L	0.594	0.29
67_Y	85_M	0.591	0.28
20_K	23_P	0.591	0.28
108_M	126_V	0.590	0.28
56_N	60_P	0.585	0.28
41_F	106_T	0.585	0.28
88_Q	95_E	0.581	0.28
67_Y	70_M	0.577	0.28
89_L	107_T	0.573	0.27
22_M	49_A	0.571	0.27
46_G	103_A	0.571	0.27
83_Y	110_F	0.571	0.27
49_A	94_K	0.571	0.27
14_F	22_M	0.569	0.27
101_V	143_I	0.568	0.27
62_Q	69_Q	0.566	0.27
16_G	34_S	0.564	0.27
26_I	143_I	0.562	0.27
81_M	110_F	0.562	0.27
57_S	80_E	0.562	0.27
33_A	129_A	0.557	0.26
22_M	44_F	0.556	0.26
101_V	122_V	0.551	0.26
107_T	117_D	0.546	0.26
8_K	36_Y	0.539	0.25
84_P	105_S	0.539	0.25
57_S	100_K	0.539	0.25
30_G	45_W	0.537	0.25
24_V	40_L	0.536	0.25
55_L	143_I	0.536	0.25
56_N	91_Q	0.535	0.25
63_I	66_N	0.534	0.25
36_Y	132_L	0.534	0.25
51_T	117_D	0.531	0.25
45_W	71_G	0.529	0.25
82_K	105_S	0.526	0.24
23_P	71_G	0.525	0.24
25_G	50_I	0.525	0.24
23_P	128_V	0.524	0.24
38_V	41_F	0.523	0.24
27_L	30_G	0.518	0.24
64_D	70_M	0.518	0.24
18_I	22_M	0.518	0.24
49_A	122_V	0.516	0.24
29_S	129_A	0.516	0.24
96_I	101_V	0.516	0.24
58_Q	103_A	0.516	0.24
29_S	32_A	0.515	0.24
9_L	97_G	0.515	0.24
42_F	119_A	0.514	0.24
45_W	111_F	0.512	0.24
88_Q	138_G	0.509	0.23
17_T	64_D	0.507	0.23
17_T	68_E	0.502	0.23
37_E	130_T	0.501	0.23
78_M	128_V	0.500	0.23
87_H	114_K	0.500	0.23

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3pnxA	4	0.972	100	0.335	Contact Map
2qs7A	3	0.965	100	0.341	Contact Map
3mc3A	3	0.7343	99.8	0.649	Contact Map
1jx7A	5	0.7762	99.5	0.726	Contact Map
1l1sA	3	0.7413	99.4	0.738	Contact Map
2hy5B	1	0.7902	99.3	0.745	Contact Map
2d1pB	1	0.7902	99	0.781	Contact Map
2pd2A	3	0.7133	98.9	0.79	Contact Map
2hy5A	2	0.7832	98.8	0.799	Contact Map
2fb6A	3	0.7692	98.6	0.808	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.