Q97Z12 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97Z12 - Heterodisulfide reductase subunit C (HdrC-2)

UniProt:	Q97Z12	Sequences: MPIPELEKPIIKGLIQKDKVIVDGVELDGTWNAFMIERTQTGYDPTVWDEIANTLEGVTISACWQCGTCTSGCTMREYDPDYSPRRFIDLARKGDKQALIELQNSLWRCVSCQKCTHRCPKGVLVEEVVHSIHHYLLKHGLVKKDPGTVFDELFLETVIKNGGRISELTLGAAAAKAGMVTLSLKDLINIGAAILKGGLIKDVLRPNRVKNWDKIQKVLEEAMKEEVVPE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	230 (182)
Sequences:	412 (263)
Seq/√Len:	19.5

SULSO - Q97Z12 Q97W78

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
159_I	223_M	5.053	1.00
106_L	132_I	3.923	1.00
95_D	98_A	3.705	1.00
52_A	59_T	2.670	0.98
163_G	167_E	2.428	0.97
98_A	101_E	2.269	0.95
36_I	40_Q	2.081	0.92
99_L	106_L	2.076	0.92
96_K	101_E	1.961	0.89
89_D	92_R	1.958	0.89
67_G	107_W	1.952	0.89
113_Q	126_E	1.929	0.89
212_W	216_Q	1.887	0.87
103_Q	140_G	1.768	0.84
44_D	52_A	1.725	0.82
50_E	53_N	1.671	0.80
97_Q	216_Q	1.636	0.79
154_F	164_R	1.635	0.78
64_W	150_F	1.574	0.76
126_E	130_H	1.563	0.75
35_M	39_T	1.527	0.73
192_A	196_K	1.525	0.73
213_D	217_K	1.498	0.72
51_I	125_V	1.491	0.72
38_R	114_K	1.482	0.71
46_T	49_D	1.448	0.69
98_A	213_D	1.443	0.69
167_E	172_A	1.440	0.69
46_T	50_E	1.409	0.67
167_E	198_G	1.398	0.67
129_V	176_K	1.395	0.66
72_G	126_E	1.378	0.65
66_C	119_C	1.368	0.65
66_C	115_C	1.368	0.65
66_C	109_C	1.368	0.65
66_C	73_C	1.368	0.65
66_C	69_C	1.368	0.65
69_C	73_C	1.368	0.65
63_C	119_C	1.368	0.65
63_C	115_C	1.368	0.65
63_C	112_C	1.368	0.65
63_C	109_C	1.368	0.65
63_C	73_C	1.368	0.65
63_C	69_C	1.368	0.65
115_C	119_C	1.368	0.65
112_C	119_C	1.368	0.65
69_C	109_C	1.368	0.65
73_C	119_C	1.368	0.65
73_C	115_C	1.368	0.65
73_C	112_C	1.368	0.65
109_C	112_C	1.368	0.65
73_C	109_C	1.368	0.65
66_C	112_C	1.368	0.65
69_C	119_C	1.368	0.65
109_C	115_C	1.368	0.65
109_C	119_C	1.368	0.65
69_C	115_C	1.368	0.65
69_C	112_C	1.368	0.65
112_C	115_C	1.368	0.65
63_C	66_C	1.368	0.65
62_A	123_V	1.365	0.65
206_P	209_V	1.360	0.64
106_L	188_I	1.354	0.64
188_I	191_G	1.340	0.63
128_V	131_S	1.306	0.61
40_Q	47_V	1.295	0.60
217_K	221_E	1.273	0.59
133_H	168_L	1.266	0.59
138_K	213_D	1.263	0.58
58_V	85_R	1.260	0.58
87_F	106_L	1.258	0.58
65_Q	74_T	1.256	0.58
59_T	128_V	1.247	0.57
87_F	103_Q	1.245	0.57
43_Y	46_T	1.240	0.57
148_T	154_F	1.230	0.56
45_P	220_E	1.205	0.55
166_S	169_T	1.204	0.55
68_T	129_V	1.184	0.53
167_E	199_L	1.181	0.53
220_E	224_K	1.171	0.53
156_E	224_K	1.164	0.52
171_G	190_I	1.152	0.51
156_E	169_T	1.141	0.51
35_M	40_Q	1.141	0.51
88_I	125_V	1.136	0.50
101_E	216_Q	1.135	0.50
55_L	138_K	1.135	0.50
60_I	91_A	1.119	0.49
163_G	176_K	1.105	0.48
185_K	192_A	1.105	0.48
175_A	180_V	1.100	0.48
161_N	211_N	1.093	0.48
64_W	89_D	1.083	0.47
193_A	196_K	1.073	0.46
220_E	223_M	1.069	0.46
114_K	117_H	1.063	0.46
99_L	221_E	1.057	0.45
132_I	164_R	1.052	0.45
188_I	196_K	1.049	0.45
49_D	53_N	1.039	0.44
147_G	166_S	1.029	0.44
71_S	174_A	1.025	0.43
168_L	171_G	1.020	0.43
130_H	187_L	1.011	0.42
185_K	188_I	1.005	0.42
209_V	215_I	1.002	0.42
67_G	120_P	0.975	0.40
60_I	128_V	0.972	0.40
91_A	193_A	0.970	0.40
163_G	173_A	0.969	0.40
88_I	123_V	0.969	0.40
101_E	220_E	0.968	0.40
208_R	212_W	0.968	0.40
36_I	47_V	0.965	0.40
64_W	68_T	0.963	0.39
134_H	222_A	0.959	0.39
96_K	103_Q	0.951	0.39
81_D	194_I	0.941	0.38
154_F	170_L	0.941	0.38
122_G	178_G	0.934	0.38
81_D	104_N	0.920	0.37
122_G	127_E	0.906	0.36
171_G	185_K	0.906	0.36
74_T	128_V	0.896	0.35
125_V	131_S	0.893	0.35
75_M	148_T	0.892	0.35
70_T	83_S	0.887	0.35
160_K	165_I	0.884	0.35
191_G	194_I	0.883	0.35
154_F	167_E	0.874	0.34
68_T	105_S	0.874	0.34
83_S	88_I	0.867	0.34
196_K	210_K	0.866	0.34
111_S	133_H	0.865	0.34
62_A	170_L	0.863	0.34
81_D	204_L	0.858	0.33
71_S	90_L	0.856	0.33
195_L	224_K	0.856	0.33
141_L	160_K	0.846	0.33
88_I	128_V	0.838	0.32
141_L	144_K	0.835	0.32
150_F	174_A	0.835	0.32
80_P	207_N	0.831	0.32
194_I	198_G	0.829	0.32
37_E	47_V	0.824	0.31
150_F	199_L	0.821	0.31
57_G	129_V	0.819	0.31
96_K	139_H	0.816	0.31
48_W	51_I	0.813	0.31
173_A	205_R	0.812	0.31
104_N	173_A	0.809	0.31
87_F	110_V	0.807	0.30
131_S	207_N	0.802	0.30
207_N	212_W	0.799	0.30
45_P	48_W	0.790	0.29
205_R	223_M	0.779	0.29
41_T	47_V	0.777	0.29
85_R	121_K	0.774	0.29
55_L	58_V	0.773	0.29
221_E	224_K	0.772	0.29
180_V	185_K	0.766	0.28
72_G	114_K	0.766	0.28
188_I	192_A	0.765	0.28
101_E	139_H	0.762	0.28
78_Y	158_V	0.758	0.28
208_R	213_D	0.752	0.27
108_R	117_H	0.752	0.27
190_I	193_A	0.752	0.27
39_T	42_G	0.749	0.27
154_F	200_I	0.744	0.27
150_F	154_F	0.743	0.27
52_A	190_I	0.738	0.27
139_H	224_K	0.724	0.26
72_G	150_F	0.724	0.26
93_K	173_A	0.719	0.26
82_Y	103_Q	0.710	0.25
150_F	167_E	0.710	0.25
136_L	141_L	0.705	0.25
142_V	148_T	0.704	0.25
89_D	184_L	0.704	0.25
65_Q	90_L	0.690	0.24
123_V	208_R	0.686	0.24
151_D	170_L	0.685	0.24
175_A	184_L	0.685	0.24
86_R	129_V	0.681	0.24
106_L	136_L	0.681	0.24
78_Y	218_V	0.674	0.24
172_A	195_L	0.672	0.24
93_K	170_L	0.669	0.23
135_Y	218_V	0.669	0.23
188_I	213_D	0.669	0.23
164_R	170_L	0.667	0.23
100_I	136_L	0.666	0.23
173_A	195_L	0.666	0.23
115_C	120_P	0.662	0.23
73_C	120_P	0.662	0.23
112_C	120_P	0.662	0.23
69_C	120_P	0.662	0.23
66_C	120_P	0.662	0.23
109_C	120_P	0.662	0.23
63_C	120_P	0.662	0.23
146_P	208_R	0.661	0.23
53_N	161_N	0.660	0.23
121_K	175_A	0.656	0.23
85_R	123_V	0.655	0.23
94_G	150_F	0.654	0.23
80_P	114_K	0.647	0.22
37_E	219_L	0.646	0.22
61_S	110_V	0.645	0.22
50_E	219_L	0.645	0.22
116_T	166_S	0.639	0.22
175_A	185_K	0.636	0.22
171_G	200_I	0.633	0.22
82_Y	193_A	0.633	0.22
90_L	129_V	0.632	0.22
139_H	194_I	0.632	0.22
165_I	168_L	0.629	0.22
35_M	114_K	0.628	0.22
178_G	185_K	0.625	0.22
67_G	71_S	0.621	0.21
158_V	165_I	0.620	0.21
82_Y	200_I	0.617	0.21
97_Q	101_E	0.617	0.21
154_F	163_G	0.616	0.21
49_D	52_A	0.606	0.21
185_K	221_E	0.596	0.20
68_T	77_E	0.594	0.20
81_D	114_K	0.593	0.20
163_G	191_G	0.592	0.20
72_G	92_R	0.592	0.20
158_V	169_T	0.591	0.20
110_V	126_E	0.591	0.20
44_D	139_H	0.590	0.20
70_T	116_T	0.583	0.20
110_V	127_E	0.582	0.20
67_G	121_K	0.577	0.19
96_K	108_R	0.576	0.19
163_G	199_L	0.576	0.19
138_K	142_V	0.571	0.19
114_K	151_D	0.570	0.19
62_A	113_Q	0.569	0.19
100_I	177_A	0.562	0.19
145_D	170_L	0.562	0.19
116_T	126_E	0.561	0.19
150_F	176_K	0.558	0.19
84_P	92_R	0.557	0.19
149_V	178_G	0.556	0.19
144_K	198_G	0.555	0.19
45_P	223_M	0.554	0.19
71_S	184_L	0.553	0.19
36_I	39_T	0.551	0.18
161_N	200_I	0.549	0.18
53_N	148_T	0.549	0.18
51_I	54_T	0.546	0.18
38_R	126_E	0.545	0.18
205_R	212_W	0.542	0.18
83_S	110_V	0.542	0.18
194_I	203_V	0.540	0.18
169_T	224_K	0.538	0.18
90_L	219_L	0.538	0.18
197_G	205_R	0.536	0.18
75_M	110_V	0.532	0.18
58_V	104_N	0.526	0.18
60_I	65_Q	0.526	0.18
118_R	140_G	0.525	0.17
47_V	51_I	0.524	0.17
124_L	127_E	0.516	0.17
142_V	212_W	0.516	0.17
150_F	163_G	0.511	0.17
53_N	205_R	0.505	0.17
53_N	218_V	0.502	0.17
169_T	178_G	0.500	0.17

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1kf6B	1	0.6391	99.9	0.695	Contact Map
3kwlA	1	0.8174	99.9	0.697	Contact Map
2h88B	1	0.6043	99.9	0.698	Contact Map
2wdqB	1	0.613	99.9	0.704	Contact Map
2bs2B	1	0.6043	99.8	0.72	Contact Map
4ysxB	1	0.6609	99.8	0.726	Contact Map
4p6vA	1	0.4609	99.1	0.821	Contact Map
3i9v9	1	0.6609	99.1	0.822	Contact Map
3cf4A	2	0.9478	98.9	0.84	Contact Map
3c8yA	1	0.9522	98	0.875	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0081 seconds.