Q97YZ5 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97YZ5 - Monoamine oxidase regulatory protein

UniProt:	Q97YZ5	Sequences: MRELLNFRNNYIAFLFSYNMFFDDFQVGQKWESKGRTITDADVVIFTGITGALNPLFLDEEYGKKTRFKGRIIPGLLTASIAIGLTYQLPVDPFGEGFVALTKLEMDAKKPVKIGDTLRAIVEVTDKKEREKDGRVYLTIRTLNQLGEEVMTLKMEILCNKRS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	163 (135)
Sequences:	6897 (4527)
Seq/√Len:	389.6

ECOLI - PAAZ
BACSU - YDEM
HALSA - Q9HN18 Q9HRM9
SULSO - Q97YZ5 Q97U86

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
30_K	121_I	2.884	1.00
70_G	113_K	2.725	1.00
22_F	127_K	2.685	1.00
30_K	123_E	2.571	1.00
37_T	117_T	2.565	1.00
125_T	139_T	2.381	1.00
105_E	154_K	2.300	1.00
126_D	137_Y	2.271	1.00
26_Q	29_Q	2.230	1.00
110_K	148_E	2.119	1.00
123_E	139_T	1.969	1.00
43_V	114_I	1.926	1.00
36_R	42_D	1.894	1.00
60_E	64_K	1.861	1.00
27_V	126_D	1.773	1.00
123_E	141_R	1.765	1.00
143_L	149_E	1.742	1.00
78_T	112_V	1.741	1.00
121_I	143_L	1.732	1.00
121_I	141_R	1.702	1.00
141_R	149_E	1.655	1.00
112_V	150_V	1.639	1.00
39_T	42_D	1.633	1.00
139_T	154_K	1.601	1.00
40_D	60_E	1.578	1.00
61_E	64_K	1.574	1.00
128_K	135_R	1.574	1.00
48_G	53_L	1.547	1.00
40_D	71_R	1.511	1.00
32_E	121_I	1.509	1.00
60_E	70_G	1.507	1.00
144_N	148_E	1.499	1.00
60_E	71_R	1.494	1.00
79_A	106_M	1.449	1.00
38_I	81_I	1.434	1.00
82_A	142_T	1.420	1.00
26_Q	127_K	1.385	1.00
77_L	81_I	1.380	1.00
116_D	145_Q	1.328	1.00
125_T	154_K	1.325	1.00
44_V	48_G	1.316	1.00
27_V	127_K	1.308	1.00
33_S	121_I	1.306	1.00
107_D	152_T	1.291	1.00
35_G	117_T	1.267	1.00
139_T	152_T	1.260	1.00
128_K	137_Y	1.236	1.00
104_L	137_Y	1.228	1.00
47_T	74_P	1.216	1.00
35_G	119_R	1.214	1.00
62_Y	65_K	1.198	1.00
137_Y	154_K	1.184	1.00
113_K	116_D	1.181	1.00
85_L	120_A	1.181	1.00
109_K	152_T	1.177	1.00
40_D	44_V	1.164	1.00
127_K	136_V	1.153	1.00
84_G	88_Q	1.152	1.00
102_T	156_E	1.139	1.00
120_A	140_I	1.136	1.00
104_L	154_K	1.115	1.00
78_T	151_M	1.101	1.00
30_K	33_S	1.098	1.00
112_V	118_L	1.097	1.00
41_A	45_I	1.081	1.00
82_A	120_A	1.080	1.00
55_P	62_Y	1.072	1.00
38_I	77_L	1.068	1.00
45_I	48_G	1.062	1.00
41_A	44_V	1.059	1.00
125_T	137_Y	1.056	1.00
116_D	144_N	1.054	1.00
119_R	143_L	1.041	1.00
57_F	75_G	1.020	1.00
142_T	151_M	1.017	1.00
122_V	138_L	1.000	1.00
42_D	45_I	0.989	1.00
120_A	142_T	0.976	1.00
59_D	62_Y	0.969	1.00
137_Y	156_E	0.962	1.00
53_L	58_L	0.949	1.00
34_K	88_Q	0.937	1.00
103_K	106_M	0.923	1.00
25_F	136_V	0.917	1.00
100_A	103_K	0.899	1.00
47_T	58_L	0.896	1.00
124_V	138_L	0.888	1.00
135_R	156_E	0.887	1.00
61_E	65_K	0.885	1.00
43_V	73_I	0.882	1.00
74_P	77_L	0.882	1.00
22_F	129_E	0.876	1.00
50_T	74_P	0.866	1.00
138_L	157_I	0.861	1.00
41_A	48_G	0.859	1.00
144_N	150_V	0.844	1.00
124_V	136_V	0.842	1.00
28_G	123_E	0.824	1.00
119_R	147_G	0.823	1.00
76_L	103_K	0.818	1.00
76_L	83_I	0.817	1.00
106_M	153_L	0.816	1.00
52_A	74_P	0.807	1.00
113_K	146_L	0.805	1.00
56_L	66_T	0.803	1.00
78_T	142_T	0.798	1.00
32_E	119_R	0.795	1.00
116_D	146_L	0.794	1.00
87_Y	90_P	0.792	1.00
149_E	152_T	0.783	1.00
89_L	122_V	0.776	1.00
102_T	105_E	0.775	1.00
101_L	158_L	0.774	1.00
37_T	115_G	0.771	1.00
76_L	79_A	0.767	1.00
109_K	149_E	0.764	1.00
73_I	77_L	0.761	1.00
110_K	144_N	0.761	1.00
133_D	158_L	0.758	1.00
62_Y	66_T	0.755	1.00
122_V	140_I	0.754	1.00
55_P	59_D	0.753	1.00
127_K	134_G	0.750	1.00
36_R	81_I	0.744	1.00
44_V	58_L	0.743	1.00
117_T	145_Q	0.742	1.00
55_P	66_T	0.742	1.00
104_L	107_D	0.740	1.00
117_T	144_N	0.731	1.00
109_K	151_M	0.720	1.00
54_N	62_Y	0.718	1.00
141_R	152_T	0.717	1.00
129_E	132_K	0.716	1.00
100_A	155_M	0.714	1.00
83_I	103_K	0.712	1.00
29_Q	127_K	0.711	1.00
70_G	114_I	0.691	0.99
71_R	114_I	0.688	0.99
72_I	113_K	0.679	0.99
82_A	153_L	0.666	0.99
144_N	147_G	0.664	0.99
103_K	155_M	0.661	0.99
64_K	69_K	0.654	0.99
68_F	111_P	0.652	0.99
130_R	135_R	0.643	0.99
57_F	74_P	0.642	0.99
76_L	80_S	0.642	0.99
42_D	51_G	0.642	0.99
145_Q	148_E	0.640	0.99
25_F	127_K	0.636	0.99
83_I	87_Y	0.635	0.99
56_L	62_Y	0.632	0.99
25_F	29_Q	0.632	0.99
118_L	150_V	0.630	0.99
52_A	57_F	0.627	0.99
104_L	156_E	0.624	0.99
79_A	108_A	0.622	0.99
82_A	140_I	0.619	0.99
76_L	108_A	0.616	0.99
69_K	113_K	0.615	0.99
64_K	67_R	0.614	0.99
36_R	84_G	0.612	0.99
47_T	52_A	0.611	0.99
45_I	50_T	0.611	0.99
66_T	69_K	0.607	0.99
37_T	42_D	0.604	0.99
64_K	70_G	0.600	0.99
130_R	158_L	0.592	0.98
51_G	77_L	0.592	0.98
143_L	147_G	0.590	0.98
95_G	98_F	0.589	0.98
25_F	124_V	0.588	0.98
82_A	151_M	0.587	0.98
118_L	142_T	0.579	0.98
72_I	111_P	0.573	0.98
98_F	133_D	0.571	0.98
87_Y	91_V	0.570	0.98
45_I	49_I	0.570	0.98
44_V	60_E	0.569	0.98
110_K	150_V	0.569	0.98
39_T	44_V	0.566	0.98
67_R	72_I	0.563	0.98
31_W	122_V	0.559	0.98
36_R	77_L	0.555	0.98
49_I	53_L	0.552	0.98
86_T	155_M	0.550	0.97
140_I	153_L	0.548	0.97
132_K	158_L	0.545	0.97
79_A	151_M	0.544	0.97
101_L	135_R	0.540	0.97
86_T	138_L	0.528	0.97
54_N	57_F	0.527	0.97
75_G	78_T	0.525	0.97
128_K	131_E	0.524	0.97
98_F	103_K	0.520	0.96
50_T	77_L	0.519	0.96
44_V	71_R	0.514	0.96
102_T	107_D	0.513	0.96
50_T	57_F	0.510	0.96
130_R	133_D	0.507	0.96
82_A	155_M	0.504	0.96
57_F	63_G	0.500	0.96

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1q6wA	6	0.9018	100	0.275	Contact Map
3exzA	2	0.8589	100	0.276	Contact Map
2bi0A	3	0.8896	100	0.279	Contact Map
4e3eA	3	0.908	100	0.291	Contact Map
4ffuA	6	0.9387	100	0.302	Contact Map
4rv2B	2	0.8344	99.9	0.323	Contact Map
3ir3A	2	0.773	99.9	0.324	Contact Map
4w78B	2	0.7791	99.9	0.328	Contact Map
2c2iA	2	0.8834	99.9	0.331	Contact Map
3k67A	2	0.908	99.9	0.342	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.