Q97YW7 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97YW7 - Isochorismatase related protein (EntB-like1)

UniProt:	Q97YW7	Sequences: MSFFNPEEIKRLVNKNNSVLVVWDVQEGLVNSIFNKNEFIAKLKELIESARKYNVPIVYTMITPYPERFQPRIRRSFNPGDIYKEVYPKEGDVILRKNTPSIFVGTNFELMLRNAGIYSIVFTGIATDIGVETSARHAQALGFIPIVAKEAVSSADKEAHERSLLNMQRLMLVLTNKEITELWER	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	185 (162)
Sequences:	10037 (7000)
Seq/√Len:	550.0

ECOLI - RUTB YECD YCAC PNCA
BACSU - YWOC YAAI YRDC YDDQ PNCA
HALSA - Q9HMH5 Q9HQL7
SULSO - Q97YW7 Q97VZ5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
109_E	113_R	3.284	1.00
119_S	144_I	2.745	1.00
109_E	143_F	2.681	1.00
50_A	55_V	2.635	1.00
61_M	96_R	2.627	1.00
101_S	137_H	2.585	1.00
18_S	119_S	2.381	1.00
109_E	141_L	2.357	1.00
43_L	123_T	2.317	1.00
157_K	161_E	2.214	1.00
25_V	43_L	2.166	1.00
119_S	146_I	2.153	1.00
46_L	148_A	2.111	1.00
17_N	118_Y	2.091	1.00
122_F	135_A	2.069	1.00
28_G	79_P	2.006	1.00
138_A	145_P	1.921	1.00
107_N	111_M	1.911	1.00
132_E	136_R	1.825	1.00
95_L	111_M	1.821	1.00
42_K	151_A	1.805	1.00
19_V	117_I	1.804	1.00
102_I	134_S	1.798	1.00
49_S	53_Y	1.796	1.00
175_T	178_E	1.794	1.00
27_E	78_N	1.753	1.00
42_K	176_N	1.744	1.00
42_K	45_E	1.740	1.00
58_V	111_M	1.659	1.00
18_S	121_V	1.617	1.00
30_V	83_Y	1.570	1.00
27_E	84_K	1.567	1.00
93_V	111_M	1.549	1.00
149_K	175_T	1.524	1.00
149_K	173_V	1.517	1.00
22_V	47_I	1.502	1.00
127_T	160_H	1.494	1.00
60_T	102_I	1.471	1.00
51_R	92_D	1.461	1.00
78_N	81_D	1.450	1.00
121_V	148_A	1.433	1.00
35_N	38_E	1.418	1.00
154_S	160_H	1.399	1.00
150_E	176_N	1.395	1.00
44_K	48_E	1.390	1.00
56_P	115_A	1.385	1.00
120_I	138_A	1.375	1.00
22_V	123_T	1.365	1.00
63_T	80_G	1.363	1.00
45_E	177_K	1.346	1.00
128_D	154_S	1.332	1.00
50_A	121_V	1.332	1.00
44_K	85_E	1.305	1.00
111_M	115_A	1.295	1.00
131_V	147_V	1.293	1.00
127_T	152_V	1.278	1.00
122_F	134_S	1.260	1.00
21_V	122_F	1.257	1.00
132_E	166_N	1.256	1.00
127_T	164_L	1.255	1.00
158_E	161_E	1.255	1.00
147_V	152_V	1.234	1.00
48_E	52_K	1.220	1.00
137_H	141_L	1.220	1.00
161_E	165_L	1.220	1.00
39_F	43_L	1.216	1.00
110_L	114_N	1.200	1.00
61_M	82_I	1.196	1.00
23_W	130_G	1.191	1.00
20_L	50_A	1.178	1.00
63_T	96_R	1.172	1.00
22_V	43_L	1.155	1.00
22_V	25_V	1.155	1.00
151_A	176_N	1.151	1.00
113_R	143_F	1.119	1.00
41_A	85_E	1.105	1.00
132_E	163_S	1.087	1.00
46_L	151_A	1.083	1.00
149_K	164_L	1.083	1.00
61_M	94_I	1.075	1.00
47_I	51_R	1.068	1.00
27_E	81_D	1.044	1.00
167_M	171_M	1.036	1.00
121_V	146_I	1.022	1.00
107_N	110_L	1.012	1.00
133_T	136_R	0.998	1.00
135_A	147_V	0.993	1.00
42_K	150_E	0.982	1.00
82_I	94_I	0.977	1.00
120_I	145_P	0.956	1.00
24_D	97_K	0.933	1.00
19_V	58_V	0.931	1.00
18_S	55_V	0.928	1.00
112_L	143_F	0.923	1.00
47_I	59_Y	0.919	1.00
158_E	162_R	0.906	1.00
111_M	114_N	0.902	1.00
146_I	172_L	0.894	1.00
89_K	92_D	0.894	1.00
103_F	138_A	0.891	1.00
160_H	164_L	0.884	1.00
27_E	31_N	0.881	1.00
127_T	154_S	0.879	1.00
135_A	167_M	0.873	1.00
152_V	160_H	0.870	1.00
146_I	174_L	0.868	1.00
104_V	141_L	0.862	1.00
156_D	159_A	0.858	1.00
144_I	172_L	0.853	1.00
49_S	52_K	0.847	1.00
39_F	153_S	0.839	1.00
46_L	123_T	0.835	1.00
25_V	125_I	0.833	1.00
148_A	174_L	0.827	1.00
99_T	142_G	0.825	1.00
174_L	178_E	0.814	1.00
148_A	151_A	0.814	1.00
44_K	88_P	0.813	1.00
58_V	115_A	0.811	1.00
99_T	105_G	0.811	1.00
81_D	87_Y	0.811	1.00
102_I	108_F	0.810	1.00
158_E	165_L	0.809	1.00
45_E	49_S	0.808	1.00
21_V	108_F	0.804	1.00
118_Y	144_I	0.802	1.00
45_E	176_N	0.799	1.00
59_Y	82_I	0.794	1.00
17_N	119_S	0.782	1.00
162_R	166_N	0.780	1.00
59_Y	88_P	0.780	1.00
72_R	75_R	0.774	1.00
122_F	131_V	0.774	1.00
56_P	117_I	0.771	1.00
45_E	48_E	0.765	1.00
23_W	122_F	0.764	1.00
77_F	80_G	0.757	1.00
125_I	153_S	0.756	1.00
43_L	151_A	0.750	1.00
40_I	44_K	0.747	1.00
47_I	57_I	0.743	1.00
136_R	170_L	0.737	1.00
164_L	173_V	0.733	1.00
88_P	94_I	0.724	1.00
70_Q	73_I	0.711	1.00
67_E	70_Q	0.709	1.00
31_N	37_N	0.708	1.00
88_P	92_D	0.708	1.00
135_A	145_P	0.708	1.00
128_D	166_N	0.707	1.00
137_H	140_A	0.707	1.00
29_L	130_G	0.706	1.00
19_V	112_L	0.704	1.00
41_A	45_E	0.702	1.00
41_A	44_K	0.700	1.00
159_A	162_R	0.698	1.00
123_T	151_A	0.695	1.00
27_E	83_Y	0.694	1.00
38_E	41_A	0.688	1.00
128_D	159_A	0.687	1.00
39_F	125_I	0.685	1.00
46_L	176_N	0.683	1.00
70_Q	74_R	0.682	1.00
59_Y	91_G	0.681	1.00
128_D	155_A	0.681	1.00
122_F	145_P	0.677	1.00
84_K	87_Y	0.675	1.00
78_N	84_K	0.673	1.00
159_A	165_L	0.668	1.00
93_V	115_A	0.656	1.00
56_P	111_M	0.653	1.00
51_R	91_G	0.653	1.00
67_E	74_R	0.650	1.00
165_L	168_Q	0.644	1.00
71_P	75_R	0.642	1.00
20_L	46_L	0.641	1.00
76_S	79_P	0.641	1.00
126_A	154_S	0.638	1.00
152_V	164_L	0.637	1.00
44_K	87_Y	0.637	1.00
22_V	59_Y	0.633	1.00
51_R	89_K	0.630	1.00
110_L	113_R	0.628	1.00
48_E	87_Y	0.625	1.00
25_V	83_Y	0.624	1.00
83_Y	86_V	0.618	1.00
36_K	125_I	0.617	1.00
59_Y	94_I	0.617	1.00
162_R	165_L	0.617	1.00
20_L	123_T	0.616	1.00
34_F	38_E	0.614	1.00
59_Y	92_D	0.608	1.00
61_M	80_G	0.604	1.00
40_I	83_Y	0.603	1.00
58_V	93_V	0.596	1.00
101_S	140_A	0.593	1.00
76_S	81_D	0.592	1.00
104_V	137_H	0.588	1.00
126_A	129_I	0.586	1.00
33_I	36_K	0.584	1.00
34_F	153_S	0.579	0.99
48_E	89_K	0.574	0.99
30_V	36_K	0.570	0.99
30_V	40_I	0.567	0.99
88_P	91_G	0.565	0.99
145_P	148_A	0.561	0.99
50_A	56_P	0.559	0.99
40_I	85_E	0.557	0.99
25_V	86_V	0.557	0.99
56_P	93_V	0.557	0.99
59_Y	86_V	0.556	0.99
47_I	92_D	0.556	0.99
40_I	86_V	0.556	0.99
139_Q	145_P	0.555	0.99
17_N	116_G	0.555	0.99
147_V	164_L	0.554	0.99
126_A	155_A	0.551	0.99
71_P	74_R	0.549	0.99
25_V	39_F	0.548	0.99
58_V	95_L	0.546	0.99
163_S	167_M	0.544	0.99
61_M	81_D	0.543	0.99
104_V	140_A	0.536	0.99
147_V	167_M	0.536	0.99
65_Y	68_R	0.535	0.99
47_I	50_A	0.528	0.99
23_W	131_V	0.528	0.99
149_K	160_H	0.526	0.99
31_N	78_N	0.526	0.99
26_Q	61_M	0.525	0.99
100_P	139_Q	0.525	0.99
129_I	155_A	0.520	0.99
131_V	152_V	0.517	0.99
51_R	90_E	0.516	0.99
65_Y	98_N	0.513	0.99
159_A	163_S	0.511	0.99
36_K	39_F	0.510	0.99
69_F	73_I	0.509	0.99
20_L	47_I	0.507	0.99
99_T	104_V	0.506	0.99
160_H	163_S	0.504	0.99
20_L	57_I	0.501	0.99
100_P	129_I	0.500	0.98

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3irvA	2	0.973	100	0.182	Contact Map
2fq1A	2	1	100	0.184	Contact Map
3kl2A	4	0.9568	100	0.188	Contact Map
1nbaA	4	1	100	0.197	Contact Map
3hb7A	3	0.9459	100	0.198	Contact Map
3mcwA	2	0.9568	100	0.199	Contact Map
3tg2A	2	0.9946	100	0.204	Contact Map
1nf9A	2	0.9784	100	0.204	Contact Map
3hu5A	3	0.9243	100	0.206	Contact Map
3ot4A	4	0.9946	100	0.208	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.