Q97YV8 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97YV8 - Phosphohistidine phosphatase (SixA)

UniProt:	Q97YV8	Sequences: MITLILVRHGDAEPQVDGKEDKDRKLVKKGVKQMRRVANFLEELGFNVDRIVSSPYLRAYQSAEVILEELFDDNSEKKVETFDDLTPDKEPSLFLEKLKDFVDNSTILVVGHEPYLSSFVKTISGANVEIKKGGVAVLDYDLKEGRGTLKILLSQKVLKLI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	161 (140)
Sequences:	9535 (7048)
Seq/√Len:	595.6

ECOLI - SIXA GPMB COBC GPMA
BACSU - PHOE
SULSO - Q97YV8 Q97WI1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
31_V	61_Q	3.238	1.00
3_T	137_V	2.899	1.00
3_T	106_T	2.784	1.00
11_D	29_K	2.704	1.00
7_V	66_I	2.616	1.00
3_T	139_D	2.599	1.00
11_D	27_V	2.292	1.00
13_E	27_V	2.241	1.00
31_V	65_V	2.198	1.00
35_R	65_V	2.064	1.00
5_I	48_V	2.054	1.00
7_V	37_V	2.031	1.00
111_G	115_Y	1.967	1.00
51_I	63_A	1.955	1.00
25_K	57_L	1.954	1.00
7_V	108_L	1.917	1.00
49_D	105_S	1.852	1.00
48_V	108_L	1.839	1.00
61_Q	64_E	1.815	1.00
51_I	67_L	1.785	1.00
39_N	69_E	1.758	1.00
130_I	136_A	1.714	1.00
13_E	17_D	1.688	1.00
5_I	106_T	1.656	1.00
140_Y	147_G	1.653	1.00
25_K	61_Q	1.642	1.00
60_Y	64_E	1.594	1.00
14_P	24_R	1.587	1.00
111_G	116_L	1.563	1.00
32_K	35_R	1.538	1.00
29_K	33_Q	1.523	1.00
28_K	31_V	1.472	1.00
32_K	36_R	1.468	1.00
6_L	116_L	1.450	1.00
90_E	115_Y	1.442	1.00
11_D	16_V	1.430	1.00
49_D	106_T	1.418	1.00
31_V	35_R	1.416	1.00
20_E	23_D	1.386	1.00
116_L	130_I	1.345	1.00
5_I	137_V	1.318	1.00
101_F	107_I	1.310	1.00
21_D	55_P	1.276	1.00
91_P	122_T	1.271	1.00
48_V	106_T	1.250	1.00
34_M	62_S	1.249	1.00
53_S	63_A	1.236	1.00
39_N	42_E	1.232	1.00
15_Q	132_K	1.210	1.00
35_R	69_E	1.187	1.00
113_E	117_S	1.182	1.00
5_I	135_V	1.167	1.00
35_R	68_E	1.153	1.00
53_S	60_Y	1.150	1.00
81_T	84_D	1.143	1.00
34_M	133_G	1.134	1.00
89_K	93_L	1.133	1.00
66_I	110_V	1.131	1.00
138_L	147_G	1.129	1.00
95_L	99_K	1.121	1.00
75_S	84_D	1.118	1.00
28_K	32_K	1.117	1.00
120_V	136_A	1.108	1.00
50_R	105_S	1.106	1.00
90_E	95_L	1.077	1.00
124_S	138_L	1.075	1.00
29_K	32_K	1.066	1.00
22_K	55_P	1.029	1.00
57_L	61_Q	1.024	1.00
14_P	19_K	1.023	1.00
90_E	93_L	1.015	1.00
15_Q	19_K	1.012	1.00
42_E	69_E	1.010	1.00
50_R	107_I	1.008	1.00
38_A	65_V	1.007	1.00
5_I	46_F	0.999	1.00
63_A	67_L	0.995	1.00
67_L	72_D	0.980	1.00
6_L	119_F	0.964	1.00
104_N	107_I	0.953	1.00
52_V	101_F	0.952	1.00
64_E	73_D	0.939	1.00
13_E	25_K	0.938	1.00
91_P	95_L	0.936	1.00
36_R	39_N	0.923	1.00
19_K	24_R	0.920	1.00
34_M	38_A	0.916	1.00
65_V	68_E	0.912	1.00
11_D	33_Q	0.910	1.00
93_L	96_E	0.910	1.00
53_S	59_A	0.909	1.00
63_A	110_V	0.908	1.00
47_N	72_D	0.907	1.00
38_A	69_E	0.902	1.00
97_K	101_F	0.898	1.00
24_R	27_V	0.896	1.00
12_A	27_V	0.896	1.00
52_V	107_I	0.893	1.00
7_V	110_V	0.888	1.00
51_I	108_L	0.883	1.00
46_F	106_T	0.868	1.00
89_K	95_L	0.867	1.00
7_V	135_V	0.858	1.00
88_D	92_S	0.858	1.00
57_L	60_Y	0.858	1.00
64_E	68_E	0.846	1.00
23_D	57_L	0.844	1.00
130_I	134_G	0.839	1.00
93_L	97_K	0.837	1.00
96_E	99_K	0.835	1.00
90_E	97_K	0.828	1.00
89_K	97_K	0.818	1.00
12_A	15_Q	0.813	1.00
61_Q	65_V	0.807	1.00
65_V	69_E	0.801	1.00
60_Y	81_T	0.786	1.00
117_S	121_K	0.783	1.00
21_D	56_Y	0.782	1.00
142_L	145_G	0.781	1.00
83_D	88_D	0.779	1.00
13_E	16_V	0.764	1.00
53_S	81_T	0.747	1.00
56_Y	59_A	0.739	1.00
40_F	135_V	0.734	1.00
49_D	108_L	0.724	1.00
67_L	70_L	0.724	1.00
59_A	63_A	0.724	1.00
14_P	22_K	0.723	1.00
89_K	115_Y	0.717	1.00
38_A	66_I	0.711	1.00
21_D	24_R	0.704	1.00
52_V	97_K	0.704	1.00
120_V	138_L	0.704	1.00
39_N	43_E	0.702	1.00
89_K	94_F	0.699	1.00
16_V	29_K	0.698	1.00
96_E	100_D	0.688	1.00
84_D	88_D	0.685	1.00
15_Q	20_E	0.681	1.00
37_V	135_V	0.679	1.00
141_D	146_R	0.673	1.00
97_K	100_D	0.672	1.00
47_N	106_T	0.671	1.00
131_K	134_G	0.670	1.00
33_Q	132_K	0.670	1.00
83_D	86_T	0.666	1.00
52_V	100_D	0.664	1.00
33_Q	36_R	0.664	1.00
35_R	39_N	0.655	1.00
41_L	46_F	0.647	1.00
76_E	79_V	0.643	1.00
4_L	140_Y	0.641	1.00
79_V	84_D	0.635	1.00
26_L	34_M	0.635	1.00
88_D	91_P	0.630	1.00
91_P	94_F	0.630	1.00
80_E	89_K	0.623	1.00
6_L	120_V	0.619	1.00
24_R	114_P	0.617	1.00
19_K	132_K	0.615	1.00
38_A	70_L	0.610	1.00
41_L	66_I	0.605	1.00
33_Q	133_G	0.604	1.00
53_S	110_V	0.600	1.00
75_S	86_T	0.598	1.00
100_D	105_S	0.596	1.00
34_M	65_V	0.595	1.00
90_E	94_F	0.594	1.00
85_L	115_Y	0.593	1.00
20_E	56_Y	0.591	1.00
101_F	105_S	0.590	1.00
70_L	73_D	0.589	1.00
78_K	81_T	0.584	1.00
64_E	67_L	0.584	1.00
12_A	24_R	0.582	1.00
120_V	130_I	0.580	1.00
22_K	56_Y	0.577	1.00
74_N	77_K	0.574	1.00
82_F	118_S	0.573	1.00
95_L	122_T	0.568	1.00
120_V	124_S	0.567	1.00
99_K	102_V	0.562	1.00
82_F	85_L	0.562	1.00
79_V	85_L	0.560	1.00
119_F	123_I	0.559	1.00
92_S	96_E	0.555	0.99
19_K	22_K	0.553	0.99
117_S	129_E	0.552	0.99
101_F	104_N	0.551	0.99
54_S	112_H	0.551	0.99
6_L	109_V	0.547	0.99
85_L	90_E	0.547	0.99
41_L	48_V	0.541	0.99
86_T	122_T	0.540	0.99
94_F	98_L	0.539	0.99
11_D	132_K	0.539	0.99
54_S	59_A	0.533	0.99
59_A	112_H	0.533	0.99
74_N	79_V	0.532	0.99
66_I	108_L	0.530	0.99
15_Q	27_V	0.524	0.99
68_E	73_D	0.523	0.99
38_A	42_E	0.523	0.99
5_I	108_L	0.522	0.99
36_R	40_F	0.511	0.99
89_K	92_S	0.510	0.99
50_R	100_D	0.508	0.99
114_P	117_S	0.506	0.99
12_A	19_K	0.503	0.99
115_Y	119_F	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2rflA	1	0.9255	100	0.24	Contact Map
3gp3A	1	0.9441	100	0.245	Contact Map
2yn2A	1	0.9814	100	0.253	Contact Map
1e58A	2	0.9938	100	0.255	Contact Map
3d8hA	2	0.9503	100	0.257	Contact Map
3kkkA	3	0.9441	100	0.258	Contact Map
4ij5A	2	0.9627	100	0.258	Contact Map
1h2eA	1	0.9627	100	0.258	Contact Map
4embA	2	0.9938	100	0.263	Contact Map
1ujcA	1	0.9441	100	0.266	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.