Q97YU0 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97YU0 - First ORF in transposon ISC1904

UniProt:	Q97YU0	Sequences: MLRPKEACQRLGISYATLREYVKKGYIKPVILQSGKQRFGEEDVERLMGIIRKRKVILYARVSSSTQKDELVNQVKYLEEQVKEYDLVITDIGSGLNMKRKGFLKLLRMILNNEVSRVVVAYPDRLVRVGFEILEEVCKAHNCEIVVLNQEDKEEELVEDLMSALVSFSGKLYGMRSHEYEKVKKCAEELKNWKI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	195 (184)
Sequences:	474 (332)
Seq/√Len:	24.5

SULSO - Q97YU0 Q97YX0 Q97YH2 Q97U52 Q97U67 Q97XB5 Q97YI6 Q97UQ9 Q97XI0 Q97XQ1 Q97XZ4 Q97X40 Q97Z60 Q97X25 Q97WZ6 Q97Y49

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
56_V	117_R	4.185	1.00
60_A	78_L	4.057	1.00
82_V	119_V	3.502	1.00
117_R	144_E	3.422	1.00
58_L	148_L	2.722	0.99
7_A	11_L	2.678	0.99
110_I	138_C	2.627	0.99
13_I	21_Y	2.553	0.99
103_F	126_L	2.521	0.99
91_D	102_G	2.493	0.99
17_T	21_Y	2.401	0.98
85_Y	146_V	2.301	0.98
5_K	9_Q	2.263	0.97
135_E	139_K	2.245	0.97
111_L	141_H	2.204	0.97
16_A	19_R	2.086	0.96
106_L	115_V	2.082	0.96
18_L	39_F	2.050	0.95
2_L	7_A	2.041	0.95
75_V	88_V	1.990	0.94
119_V	132_E	1.965	0.94
22_V	37_Q	1.917	0.93
58_L	78_L	1.886	0.93
98_M	132_E	1.820	0.91
96_L	129_V	1.799	0.91
110_I	115_V	1.782	0.90
75_V	90_T	1.775	0.90
55_K	109_M	1.701	0.88
77_Y	121_A	1.682	0.88
58_L	88_V	1.614	0.85
110_I	118_V	1.594	0.84
27_I	30_V	1.593	0.84
89_I	102_G	1.566	0.83
127_V	131_F	1.560	0.83
98_M	167_S	1.559	0.83
131_F	145_I	1.557	0.83
3_R	34_S	1.554	0.83
131_F	147_V	1.541	0.82
22_V	29_P	1.502	0.81
4_P	19_R	1.497	0.80
109_M	114_E	1.489	0.80
138_C	143_C	1.449	0.78
16_A	24_K	1.445	0.78
166_V	177_S	1.445	0.78
12_G	142_N	1.428	0.77
40_G	43_D	1.401	0.76
110_I	120_V	1.389	0.75
17_T	20_E	1.373	0.74
57_I	75_V	1.365	0.74
155_E	159_E	1.365	0.74
56_V	144_E	1.363	0.74
70_E	73_N	1.353	0.73
8_C	13_I	1.352	0.73
122_Y	159_E	1.331	0.72
72_V	76_K	1.331	0.72
119_V	146_V	1.331	0.72
4_P	18_L	1.306	0.70
14_S	20_E	1.300	0.70
96_L	130_G	1.296	0.70
26_Y	33_Q	1.278	0.69
167_S	170_G	1.273	0.68
22_V	27_I	1.251	0.67
7_A	44_V	1.247	0.67
31_I	37_Q	1.243	0.67
121_A	178_H	1.226	0.65
107_L	111_L	1.213	0.65
76_K	79_E	1.192	0.63
7_A	27_I	1.179	0.62
91_D	167_S	1.162	0.61
2_L	38_R	1.161	0.61
183_V	186_C	1.144	0.60
22_V	39_F	1.139	0.60
64_S	67_Q	1.138	0.60
138_C	172_L	1.134	0.59
62_V	67_Q	1.121	0.58
56_V	119_V	1.119	0.58
166_V	170_G	1.102	0.57
8_C	15_Y	1.096	0.57
67_Q	70_E	1.095	0.57
15_Y	19_R	1.091	0.56
56_V	93_G	1.080	0.55
3_R	38_R	1.076	0.55
89_I	118_V	1.072	0.55
50_I	114_E	1.068	0.55
170_G	175_M	1.066	0.54
54_R	142_N	1.063	0.54
20_E	23_K	1.054	0.54
58_L	82_V	1.052	0.53
78_L	148_L	1.051	0.53
164_A	174_G	1.050	0.53
89_I	106_L	1.049	0.53
95_G	126_L	1.036	0.52
173_Y	176_R	1.025	0.52
62_V	71_L	1.018	0.51
57_I	89_I	1.006	0.50
131_F	134_L	0.999	0.50
28_K	43_D	0.993	0.49
27_I	134_L	0.993	0.49
8_C	18_L	0.986	0.49
68_K	179_E	0.986	0.49
43_D	46_R	0.971	0.48
81_Q	146_V	0.971	0.48
14_S	172_L	0.964	0.47
13_I	20_E	0.962	0.47
82_V	85_Y	0.947	0.46
138_C	169_S	0.944	0.46
170_G	177_S	0.935	0.45
75_V	107_L	0.934	0.45
127_V	134_L	0.928	0.45
161_L	165_L	0.927	0.45
117_R	146_V	0.926	0.44
134_L	138_C	0.925	0.44
171_K	175_M	0.914	0.44
11_L	18_L	0.911	0.43
19_R	31_I	0.908	0.43
129_V	160_D	0.906	0.43
3_R	33_Q	0.901	0.43
158_V	161_L	0.901	0.43
27_I	43_D	0.894	0.42
44_V	118_V	0.893	0.42
91_D	121_A	0.884	0.42
19_R	39_F	0.883	0.41
67_Q	73_N	0.878	0.41
159_E	170_G	0.877	0.41
156_E	168_F	0.858	0.40
42_E	73_N	0.854	0.39
26_Y	34_S	0.854	0.39
8_C	171_K	0.848	0.39
18_L	22_V	0.842	0.39
4_P	29_P	0.838	0.38
22_V	31_I	0.831	0.38
39_F	43_D	0.823	0.37
110_I	143_C	0.817	0.37
98_M	127_V	0.811	0.37
73_N	162_M	0.807	0.36
7_A	18_L	0.803	0.36
19_R	22_V	0.798	0.36
4_P	15_Y	0.797	0.36
157_L	166_V	0.792	0.35
23_K	31_I	0.792	0.35
153_K	175_M	0.779	0.34
97_N	141_H	0.774	0.34
5_K	34_S	0.774	0.34
79_E	88_V	0.773	0.34
84_E	119_V	0.773	0.34
4_P	7_A	0.769	0.34
93_G	163_S	0.768	0.34
81_Q	85_Y	0.764	0.33
77_Y	149_N	0.762	0.33
64_S	73_N	0.761	0.33
7_A	38_R	0.760	0.33
120_V	147_V	0.759	0.33
63_S	67_Q	0.757	0.33
101_K	154_E	0.751	0.33
155_E	158_V	0.751	0.33
129_V	164_A	0.747	0.32
6_E	146_V	0.738	0.32
166_V	178_H	0.737	0.32
118_V	183_V	0.723	0.31
2_L	11_L	0.721	0.31
161_L	174_G	0.720	0.31
57_I	106_L	0.719	0.31
54_R	143_C	0.717	0.31
72_V	75_V	0.710	0.30
95_G	103_F	0.709	0.30
87_L	100_R	0.702	0.30
33_Q	113_N	0.692	0.29
107_L	146_V	0.689	0.29
24_K	52_R	0.686	0.29
108_R	140_A	0.686	0.29
96_L	133_I	0.676	0.28
78_L	143_C	0.674	0.28
120_V	160_D	0.674	0.28
6_E	43_D	0.672	0.28
55_K	116_S	0.666	0.28
111_L	137_V	0.664	0.27
30_V	38_R	0.661	0.27
100_R	127_V	0.660	0.27
81_Q	149_N	0.657	0.27
9_Q	68_K	0.655	0.27
130_G	169_S	0.654	0.27
63_S	128_R	0.653	0.27
19_R	36_K	0.651	0.27
103_F	167_S	0.650	0.27
92_I	145_I	0.646	0.26
177_S	183_V	0.646	0.26
23_K	101_K	0.644	0.26
103_F	116_S	0.641	0.26
70_E	121_A	0.641	0.26
139_K	171_K	0.639	0.26
104_L	134_L	0.638	0.26
19_R	37_Q	0.637	0.26
134_L	157_L	0.629	0.25
50_I	116_S	0.624	0.25
6_E	57_I	0.623	0.25
161_L	164_A	0.621	0.25
120_V	145_I	0.620	0.25
57_I	115_V	0.617	0.25
4_P	8_C	0.616	0.25
13_I	16_A	0.613	0.25
121_A	166_V	0.612	0.25
160_D	174_G	0.612	0.25
57_I	150_Q	0.608	0.24
6_E	157_L	0.607	0.24
15_Y	37_Q	0.605	0.24
103_F	127_V	0.603	0.24
160_D	164_A	0.601	0.24
14_S	22_V	0.599	0.24
148_L	154_E	0.596	0.24
77_Y	163_S	0.596	0.24
85_Y	96_L	0.594	0.24
86_D	119_V	0.593	0.24
76_K	80_E	0.590	0.23
2_L	22_V	0.589	0.23
85_Y	148_L	0.589	0.23
118_V	145_I	0.588	0.23
115_V	143_C	0.586	0.23
129_V	174_G	0.583	0.23
8_C	103_F	0.582	0.23
12_G	129_V	0.580	0.23
3_R	36_K	0.578	0.23
10_R	90_T	0.577	0.23
44_V	48_M	0.568	0.22
64_S	174_G	0.567	0.22
30_V	43_D	0.566	0.22
147_V	165_L	0.562	0.22
118_V	171_K	0.561	0.22
54_R	112_N	0.560	0.22
73_N	76_K	0.559	0.22
110_I	147_V	0.559	0.22
165_L	169_S	0.559	0.22
107_L	118_V	0.558	0.22
16_A	20_E	0.557	0.22
29_P	175_M	0.557	0.22
5_K	8_C	0.557	0.22
98_M	103_F	0.554	0.22
99_K	162_M	0.553	0.22
26_Y	165_L	0.552	0.22
91_D	145_I	0.549	0.21
8_C	12_G	0.547	0.21
130_G	146_V	0.546	0.21
81_Q	148_L	0.546	0.21
51_I	106_L	0.544	0.21
137_V	140_A	0.543	0.21
34_S	113_N	0.543	0.21
13_I	31_I	0.541	0.21
58_L	149_N	0.537	0.21
64_S	120_V	0.534	0.21
21_Y	38_R	0.534	0.21
119_V	134_L	0.533	0.21
97_N	106_L	0.529	0.20
2_L	13_I	0.529	0.20
32_L	41_E	0.527	0.20
99_K	141_H	0.527	0.20
28_K	47_L	0.525	0.20
120_V	143_C	0.524	0.20
127_V	163_S	0.522	0.20
119_V	136_E	0.521	0.20
56_V	116_S	0.521	0.20
96_L	156_E	0.518	0.20
169_S	175_M	0.517	0.20
21_Y	157_L	0.516	0.20
157_L	160_D	0.515	0.20
70_E	132_E	0.515	0.20
126_L	133_I	0.514	0.20
118_V	126_L	0.514	0.20
157_L	168_F	0.513	0.20
118_V	147_V	0.511	0.20
119_V	181_E	0.506	0.19
92_I	100_R	0.506	0.19
181_E	185_K	0.504	0.19
66_T	166_V	0.503	0.19
124_D	128_R	0.502	0.19
177_S	180_Y	0.502	0.19
5_K	19_R	0.501	0.19
77_Y	178_H	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ilxA	2	0.7077	100	0.652	Contact Map
3lhkA	2	0.7231	99.9	0.662	Contact Map
3g13A	2	0.7179	99.8	0.74	Contact Map
3bvpA	4	0.6154	99.8	0.746	Contact Map
4bqqA	2	0.7026	99.8	0.749	Contact Map
3guvA	2	0.6769	99.8	0.75	Contact Map
2mhcA	1	0.5538	99.8	0.752	Contact Map
2gm5A	4	0.6051	99.8	0.759	Contact Map
1gdtA	2	0.6923	99.7	0.765	Contact Map
3pkzA	4	0.5744	99.7	0.766	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.