Q97YT3 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97YT3 - Uncharacterized protein

UniProt:	Q97YT3	Sequences: MNILNKLGISDELADMLINEAVRKAKELGVNVSIAIVDEGGELKAFKRMDGAPILTIQIAIDKSWTAVSFGIPTHEWYNILKDNPSLAMGFPKIPRLIIFGGGFPIIYKEQVIGGIGVSGASAEQDMEIAKSALKRLES	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	139 (128)
Sequences:	2379 (1572)
Seq/√Len:	139.0

ECOLI - GLCG
SULSO - Q97YT3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
24_K	27_E	3.693	1.00
18_I	45_A	3.559	1.00
35_A	60_A	2.834	1.00
15_D	47_K	2.819	1.00
33_S	46_F	2.276	1.00
75_H	127_M	2.242	1.00
131_K	135_K	2.141	1.00
24_K	28_L	2.092	1.00
35_A	46_F	2.023	1.00
35_A	43_L	2.018	1.00
24_K	128_E	1.976	1.00
43_L	46_F	1.914	1.00
121_A	125_Q	1.877	1.00
106_I	134_L	1.876	1.00
32_V	129_I	1.866	1.00
73_P	105_P	1.800	1.00
15_D	22_V	1.735	1.00
107_I	112_V	1.719	1.00
17_L	133_A	1.661	1.00
37_V	115_G	1.646	1.00
65_W	96_R	1.613	1.00
35_A	61_I	1.611	1.00
9_I	44_K	1.601	1.00
14_A	45_A	1.491	1.00
101_G	127_M	1.475	1.00
62_D	96_R	1.471	1.00
26_K	49_M	1.469	1.00
59_I	119_S	1.437	1.00
21_A	133_A	1.432	1.00
118_V	130_A	1.428	1.00
17_L	106_I	1.400	1.00
33_S	56_T	1.355	1.00
11_D	47_K	1.330	1.00
104_F	127_M	1.327	1.00
22_V	47_K	1.319	1.00
100_F	123_A	1.295	1.00
15_D	19_N	1.265	1.00
46_F	57_I	1.257	1.00
74_T	103_G	1.249	1.00
28_L	128_E	1.230	1.00
58_Q	61_I	1.228	1.00
22_V	34_I	1.215	1.00
17_L	116_I	1.214	1.00
70_F	77_W	1.209	1.00
20_E	136_R	1.204	1.00
21_A	116_I	1.201	1.00
55_L	70_F	1.195	1.00
23_R	27_E	1.183	1.00
75_H	101_G	1.179	1.00
10_S	13_L	1.174	1.00
106_I	114_G	1.160	0.99
25_A	129_I	1.158	0.99
25_A	32_V	1.158	0.99
21_A	34_I	1.151	0.99
127_M	131_K	1.113	0.99
31_N	51_G	1.107	0.99
122_S	125_Q	1.102	0.99
65_W	69_S	1.090	0.99
30_V	121_A	1.083	0.99
8_G	39_E	1.076	0.99
76_E	79_N	1.064	0.99
22_V	26_K	1.062	0.99
91_F	95_P	1.062	0.99
101_G	123_A	1.055	0.99
13_L	108_Y	1.052	0.99
32_V	121_A	1.038	0.99
19_N	23_R	1.034	0.99
51_G	111_Q	1.015	0.99
33_S	52_A	1.014	0.99
21_A	118_V	1.009	0.98
25_A	49_M	1.000	0.98
52_A	56_T	0.994	0.98
11_D	15_D	0.989	0.98
19_N	47_K	0.980	0.98
38_D	48_R	0.978	0.98
108_Y	113_I	0.976	0.98
18_I	36_I	0.961	0.98
62_D	98_I	0.959	0.98
43_L	61_I	0.953	0.98
11_D	14_A	0.945	0.98
55_L	69_S	0.941	0.98
32_V	118_V	0.938	0.98
18_I	47_K	0.932	0.97
40_G	48_R	0.930	0.97
44_K	50_D	0.928	0.97
21_A	129_I	0.920	0.97
24_K	132_S	0.916	0.97
107_I	110_E	0.909	0.97
58_Q	62_D	0.895	0.97
46_F	61_I	0.885	0.97
79_N	83_D	0.873	0.96
104_F	131_K	0.870	0.96
42_E	54_I	0.868	0.96
20_E	23_R	0.866	0.96
132_S	135_K	0.864	0.96
91_F	94_I	0.862	0.96
37_V	64_S	0.850	0.96
78_Y	81_L	0.836	0.95
14_A	36_I	0.831	0.95
125_Q	128_E	0.828	0.95
20_E	133_A	0.825	0.95
32_V	120_G	0.820	0.95
59_I	98_I	0.798	0.94
33_S	57_I	0.796	0.94
67_A	74_T	0.794	0.94
36_I	45_A	0.790	0.94
16_M	20_E	0.787	0.93
22_V	49_M	0.781	0.93
16_M	19_N	0.780	0.93
28_L	125_Q	0.779	0.93
9_I	106_I	0.778	0.93
132_S	136_R	0.777	0.93
77_W	81_L	0.776	0.93
104_F	134_L	0.776	0.93
75_H	79_N	0.770	0.93
62_D	94_I	0.765	0.92
30_V	125_Q	0.762	0.92
68_V	115_G	0.762	0.92
79_N	82_K	0.761	0.92
37_V	68_V	0.754	0.92
53_P	56_T	0.747	0.92
73_P	104_F	0.744	0.91
12_E	16_M	0.735	0.91
116_I	134_L	0.731	0.91
17_L	134_L	0.727	0.90
83_D	123_A	0.721	0.90
115_G	134_L	0.717	0.90
54_I	69_S	0.717	0.90
57_I	61_I	0.707	0.89
43_L	57_I	0.704	0.89
108_Y	111_Q	0.699	0.89
20_E	132_S	0.696	0.88
12_E	19_N	0.693	0.88
14_A	44_K	0.686	0.88
68_V	71_G	0.682	0.87
34_I	129_I	0.681	0.87
116_I	133_A	0.680	0.87
31_N	121_A	0.673	0.87
74_T	99_I	0.666	0.86
71_G	112_V	0.664	0.86
12_E	26_K	0.658	0.85
124_E	128_E	0.653	0.85
23_R	26_K	0.652	0.85
16_M	136_R	0.648	0.85
70_F	97_L	0.648	0.85
13_L	16_M	0.647	0.84
9_I	13_L	0.638	0.84
81_L	84_N	0.631	0.83
78_Y	82_K	0.630	0.83
58_Q	94_I	0.611	0.81
18_I	34_I	0.602	0.80
17_L	20_E	0.600	0.80
103_G	130_A	0.599	0.80
93_K	99_I	0.598	0.80
46_F	60_A	0.597	0.79
89_M	92_P	0.596	0.79
28_L	129_I	0.595	0.79
85_P	100_F	0.590	0.79
55_L	59_I	0.585	0.78
10_S	44_K	0.585	0.78
105_P	112_V	0.584	0.78
90_G	93_K	0.577	0.77
34_I	116_I	0.577	0.77
9_I	39_E	0.575	0.77
104_F	130_A	0.564	0.75
73_P	131_K	0.558	0.75
66_T	74_T	0.558	0.75
18_I	32_V	0.554	0.74
88_A	92_P	0.553	0.74
44_K	48_R	0.551	0.74
53_P	123_A	0.548	0.73
66_T	97_L	0.543	0.73
86_S	97_L	0.536	0.72
81_L	99_I	0.535	0.72
40_G	68_V	0.530	0.71
33_S	120_G	0.527	0.71
88_A	97_L	0.526	0.70
88_A	91_F	0.520	0.70
15_D	45_A	0.517	0.69
28_L	121_A	0.514	0.69
76_E	83_D	0.513	0.68
103_G	118_V	0.510	0.68
52_A	96_R	0.510	0.68
31_N	49_M	0.509	0.68
129_I	132_S	0.508	0.68
70_F	94_I	0.508	0.68
55_L	93_K	0.507	0.68
59_I	81_L	0.506	0.67
21_A	32_V	0.505	0.67
11_D	50_D	0.504	0.67
29_G	111_Q	0.502	0.67
35_A	57_I	0.500	0.67

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4nkpA	5	1	100	0.172	Contact Map
2a2lA	5	1	100	0.173	Contact Map
3fpwA	5	0.9568	100	0.194	Contact Map
4clcA	5	0.9928	100	0.225	Contact Map
2ia2A	4	0.9568	82.6	0.888	Contact Map
2o0yA	4	0.9784	77.7	0.894	Contact Map
2o99A	2	0.9209	76.4	0.895	Contact Map
3d3oA	1	0.8921	76.1	0.895	Contact Map
3r4kA	2	0.9568	75.5	0.896	Contact Map
1yspA	1	0.8849	75.4	0.896	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.