Q97YS8 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97YS8 - Toluene-4-monooxygenase system protein C. (TmoC)

UniProt:	Q97YS8	Sequences: MNYPGEFHKLLTLDDIYEGEAKLVEVNRYEILVVNIKGEIKAYYARCAHALGLIESNSFDGEEKIICPVHLWEYNARTGESINPVGSSLFPLDVKVEGSDIFVKVPSVPISEFKVKWFGMYRQRGVINEFGVNS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	134 (102)
Sequences:	1520 (1074)
Seq/√Len:	106.3

ECOLI - HCAC
BACSU - NASE
SULSO - Q97YS8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
9_K	100_D	4.864	1.00
72_W	85_V	2.520	1.00
43_Y	89_L	2.507	1.00
93_D	104_K	2.449	1.00
45_A	55_E	2.421	1.00
52_G	68_P	2.286	1.00
13_L	40_I	2.162	1.00
9_K	102_F	2.087	1.00
95_K	102_F	2.025	1.00
7_F	95_K	1.942	1.00
75_N	78_T	1.848	1.00
39_E	77_R	1.782	1.00
44_Y	90_F	1.780	1.00
18_E	35_N	1.776	1.00
35_N	38_G	1.774	1.00
12_T	15_D	1.733	1.00
97_E	102_F	1.711	1.00
62_E	77_R	1.630	1.00
12_T	100_D	1.629	1.00
34_V	43_Y	1.625	1.00
21_A	65_I	1.600	1.00
30_E	45_A	1.597	1.00
59_F	76_A	1.572	1.00
62_E	75_N	1.556	1.00
21_A	34_V	1.496	1.00
29_Y	44_Y	1.452	1.00
31_I	42_A	1.443	1.00
11_L	16_I	1.425	1.00
21_A	32_L	1.404	1.00
13_L	99_S	1.394	1.00
80_E	88_S	1.384	1.00
11_L	101_I	1.365	1.00
53_L	69_V	1.300	0.99
44_Y	92_L	1.266	0.99
51_L	69_V	1.243	0.99
21_A	59_F	1.241	0.99
34_V	65_I	1.215	0.99
64_K	73_E	1.192	0.99
18_E	38_G	1.150	0.98
40_I	94_V	1.143	0.98
48_A	89_L	1.129	0.98
36_I	62_E	1.125	0.98
13_L	96_V	1.123	0.98
52_G	69_V	1.112	0.98
9_K	12_T	1.110	0.98
48_A	72_W	1.104	0.98
60_D	66_I	1.103	0.98
72_W	88_S	1.077	0.98
96_V	101_I	1.064	0.97
50_A	72_W	1.054	0.97
34_V	76_A	1.039	0.97
14_D	99_S	1.019	0.97
48_A	85_V	0.998	0.96
32_L	89_L	0.987	0.96
25_E	30_E	0.984	0.96
16_I	40_I	0.950	0.95
39_E	62_E	0.949	0.95
72_W	81_S	0.940	0.95
17_Y	20_E	0.931	0.94
72_W	86_G	0.928	0.94
16_I	22_K	0.924	0.94
17_Y	35_N	0.919	0.94
41_K	91_P	0.919	0.94
11_L	33_V	0.912	0.94
72_W	84_P	0.900	0.93
81_S	88_S	0.896	0.93
10_L	24_V	0.886	0.93
81_S	85_V	0.879	0.92
81_S	84_P	0.879	0.92
6_E	105_V	0.878	0.92
19_G	35_N	0.844	0.91
36_I	59_F	0.840	0.91
75_N	82_I	0.834	0.90
85_V	88_S	0.825	0.90
31_I	103_V	0.824	0.90
45_A	53_L	0.817	0.89
45_A	89_L	0.816	0.89
12_T	99_S	0.807	0.89
26_V	29_Y	0.804	0.89
11_L	15_D	0.798	0.88
23_L	30_E	0.798	0.88
36_I	61_G	0.793	0.88
46_R	51_L	0.776	0.87
41_K	76_A	0.772	0.87
50_A	69_V	0.766	0.86
98_G	102_F	0.765	0.86
9_K	95_K	0.753	0.85
64_K	82_I	0.749	0.85
60_D	73_E	0.743	0.84
10_L	42_A	0.737	0.84
40_I	96_V	0.714	0.82
33_V	94_V	0.711	0.82
30_E	44_Y	0.709	0.82
92_L	104_K	0.705	0.81
48_A	88_S	0.698	0.81
41_K	77_R	0.687	0.79
10_L	14_D	0.686	0.79
58_S	71_L	0.683	0.79
23_L	45_A	0.679	0.79
43_Y	91_P	0.679	0.79
51_L	83_N	0.672	0.78
71_L	85_V	0.669	0.78
16_I	33_V	0.668	0.78
48_A	81_S	0.665	0.77
46_R	53_L	0.661	0.77
48_A	74_Y	0.657	0.76
52_G	85_V	0.654	0.76
52_G	58_S	0.647	0.75
66_I	73_E	0.645	0.75
58_S	66_I	0.644	0.75
40_I	101_I	0.636	0.74
52_G	72_W	0.636	0.74
73_E	82_I	0.624	0.73
24_V	33_V	0.615	0.72
6_E	104_K	0.614	0.71
42_A	103_V	0.614	0.71
24_V	31_I	0.607	0.71
32_L	43_Y	0.604	0.70
18_E	37_K	0.600	0.70
11_L	22_K	0.592	0.69
74_Y	85_V	0.590	0.68
25_E	28_R	0.588	0.68
8_H	94_V	0.582	0.67
23_L	55_E	0.580	0.67
55_E	69_V	0.578	0.67
73_E	83_N	0.568	0.66
31_I	104_K	0.566	0.65
35_N	40_I	0.559	0.64
95_K	98_G	0.559	0.64
66_I	71_L	0.558	0.64
15_D	22_K	0.550	0.63
68_P	71_L	0.549	0.63
21_A	24_V	0.548	0.63
9_K	14_D	0.547	0.63
72_W	76_A	0.543	0.62
43_Y	46_R	0.530	0.60
19_G	77_R	0.530	0.60
50_A	58_S	0.528	0.60
13_L	18_E	0.525	0.60
44_Y	105_V	0.525	0.60
33_V	40_I	0.521	0.59
8_H	26_V	0.521	0.59
44_Y	89_L	0.520	0.59
29_Y	105_V	0.519	0.59
58_S	69_V	0.518	0.59
31_I	88_S	0.518	0.59
47_C	67_C	0.517	0.58
6_E	106_P	0.509	0.57
6_E	37_K	0.504	0.56
29_Y	92_L	0.504	0.56
17_Y	21_A	0.503	0.56
75_N	80_E	0.500	0.56
21_A	76_A	0.500	0.56

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1fqtA	2	0.7985	100	0.359	Contact Map
3dqyA	1	0.7836	100	0.359	Contact Map
3gceA	1	0.7463	100	0.363	Contact Map
2i7fA	1	0.7463	100	0.363	Contact Map
2qpzA	1	0.7612	100	0.367	Contact Map
4aivA	1	0.7836	100	0.367	Contact Map
1vm9A	1	0.7985	100	0.368	Contact Map
2de6D	1	0.7612	100	0.368	Contact Map
3d89A	1	0.8881	100	0.371	Contact Map
2jo6A	1	0.7761	100	0.382	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.