Q97YS5 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97YS5 - Uncharacterized protein

UniProt:	Q97YS5	Sequences: MKEKVVEILRQIYDPEIPINIYDLGLVREIRIEGKRIFVRLIFTANKGCTLADLVAVQVKYKLMKVFPDYNVEVKSDFNEEWNIGYATETGRLMLEEIYGKDAVEVLVNKTKIEELVSTNKVKLENFDPREYMRKAVEERYKKFREWYDKHKI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	153 (127)
Sequences:	545 (354)
Seq/√Len:	31.4

ECOLI - PAAD
SULSO - Q97YS5 Q7LXS9 Q97X89

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
26_L	55_V	4.277	1.00
41_L	52_A	3.316	1.00
22_Y	27_V	2.924	1.00
90_T	94_M	2.899	1.00
121_K	124_L	2.716	1.00
19_I	99_Y	2.676	1.00
93_L	97_E	2.649	1.00
8_I	62_K	2.606	1.00
21_I	55_V	2.477	0.99
93_L	96_E	2.454	0.99
87_A	92_R	2.413	0.99
121_K	126_N	2.134	0.98
9_L	22_Y	2.091	0.98
40_R	77_D	2.080	0.98
38_F	73_E	1.950	0.97
17_I	99_Y	1.926	0.97
83_N	86_Y	1.818	0.96
121_K	129_P	1.761	0.95
122_V	126_N	1.756	0.95
29_E	40_R	1.742	0.94
36_R	71_N	1.654	0.93
60_K	64_M	1.630	0.92
125_E	128_D	1.611	0.92
57_V	61_Y	1.588	0.91
54_L	58_Q	1.572	0.91
32_I	37_I	1.560	0.90
40_R	75_K	1.548	0.90
41_L	59_V	1.544	0.90
23_D	94_M	1.504	0.88
28_R	86_Y	1.486	0.88
9_L	27_V	1.472	0.87
124_L	129_P	1.431	0.86
113_I	117_V	1.385	0.84
23_D	90_T	1.367	0.83
122_V	129_P	1.364	0.83
8_I	66_V	1.334	0.81
41_L	55_V	1.322	0.81
17_I	53_D	1.300	0.80
26_L	41_L	1.282	0.79
69_D	72_V	1.281	0.79
36_R	73_E	1.266	0.78
47_K	86_Y	1.264	0.78
96_E	120_N	1.253	0.77
27_V	54_L	1.190	0.73
112_K	117_V	1.189	0.73
31_R	38_F	1.183	0.73
38_F	75_K	1.176	0.72
88_T	91_G	1.130	0.69
58_Q	61_Y	1.120	0.69
111_T	115_E	1.097	0.67
8_I	69_D	1.085	0.66
57_V	120_N	1.043	0.63
23_D	71_N	1.026	0.62
43_F	51_L	1.015	0.61
59_V	131_E	1.012	0.61
52_A	86_Y	1.008	0.60
6_V	20_N	1.005	0.60
5_V	133_M	0.995	0.59
81_E	86_Y	0.992	0.59
47_K	78_F	0.990	0.59
21_I	27_V	0.984	0.59
53_D	56_A	0.975	0.58
34_G	71_N	0.970	0.57
91_G	123_K	0.970	0.57
87_A	133_M	0.968	0.57
126_N	129_P	0.962	0.57
21_I	41_L	0.962	0.57
20_N	90_T	0.960	0.57
109_N	112_K	0.958	0.56
127_F	130_R	0.945	0.55
45_A	52_A	0.940	0.55
31_R	40_R	0.928	0.54
90_T	93_L	0.921	0.53
10_R	22_Y	0.913	0.53
96_E	125_E	0.909	0.53
17_I	64_M	0.908	0.52
7_E	11_Q	0.904	0.52
17_I	93_L	0.893	0.51
52_A	55_V	0.890	0.51
42_I	84_I	0.878	0.50
57_V	60_K	0.878	0.50
23_D	91_G	0.872	0.49
41_L	45_A	0.872	0.49
5_V	8_I	0.863	0.49
6_V	10_R	0.852	0.48
42_I	86_Y	0.838	0.47
64_M	128_D	0.838	0.47
62_K	66_V	0.836	0.47
111_T	117_V	0.833	0.46
121_K	125_E	0.824	0.46
26_L	52_A	0.814	0.45
33_E	38_F	0.803	0.44
74_V	77_D	0.800	0.44
87_A	91_G	0.797	0.43
77_D	80_E	0.797	0.43
30_I	37_I	0.792	0.43
113_I	118_S	0.784	0.42
113_I	116_L	0.778	0.42
55_V	79_N	0.772	0.41
22_Y	88_T	0.768	0.41
91_G	118_S	0.767	0.41
63_L	133_M	0.765	0.41
59_V	63_L	0.757	0.40
100_G	104_V	0.753	0.40
52_A	76_S	0.751	0.40
7_E	93_L	0.748	0.40
59_V	115_E	0.748	0.40
11_Q	62_K	0.748	0.40
51_L	104_V	0.731	0.38
4_K	10_R	0.716	0.37
20_N	55_V	0.709	0.37
108_V	112_K	0.703	0.36
54_L	79_N	0.702	0.36
45_A	86_Y	0.700	0.36
43_F	104_V	0.697	0.36
18_P	78_F	0.694	0.35
39_V	64_M	0.691	0.35
125_E	129_P	0.691	0.35
53_D	76_S	0.688	0.35
45_A	101_K	0.681	0.34
37_I	72_V	0.680	0.34
65_K	123_K	0.678	0.34
47_K	87_A	0.677	0.34
84_I	104_V	0.673	0.34
45_A	66_V	0.673	0.34
23_D	87_A	0.654	0.33
59_V	76_S	0.654	0.33
125_E	133_M	0.651	0.32
96_E	123_K	0.648	0.32
32_I	106_V	0.642	0.32
89_E	107_L	0.638	0.31
91_G	119_T	0.626	0.31
36_R	72_V	0.624	0.30
13_Y	20_N	0.623	0.30
47_K	77_D	0.619	0.30
129_P	133_M	0.618	0.30
41_L	76_S	0.616	0.30
41_L	72_V	0.616	0.30
5_V	56_A	0.615	0.30
127_F	131_E	0.614	0.30
9_L	115_E	0.612	0.30
9_L	37_I	0.609	0.29
61_Y	89_E	0.603	0.29
112_K	115_E	0.600	0.29
13_Y	27_V	0.597	0.29
33_E	36_R	0.595	0.28
8_I	12_I	0.590	0.28
6_V	106_V	0.589	0.28
47_K	85_G	0.588	0.28
4_K	68_P	0.588	0.28
5_V	63_L	0.586	0.28
28_R	47_K	0.582	0.28
118_S	130_R	0.581	0.28
119_T	126_N	0.580	0.27
4_K	79_N	0.580	0.27
123_K	131_E	0.579	0.27
17_I	128_D	0.578	0.27
75_K	125_E	0.575	0.27
110_K	117_V	0.573	0.27
36_R	83_N	0.571	0.27
27_V	52_A	0.565	0.27
81_E	106_V	0.561	0.26
66_V	69_D	0.561	0.26
120_N	127_F	0.558	0.26
55_V	91_G	0.555	0.26
110_K	113_I	0.549	0.26
10_R	27_V	0.548	0.25
99_Y	130_R	0.540	0.25
10_R	33_E	0.539	0.25
18_P	23_D	0.536	0.25
51_L	101_K	0.533	0.25
10_R	90_T	0.532	0.24
42_I	80_E	0.530	0.24
114_E	117_V	0.529	0.24
65_K	71_N	0.529	0.24
28_R	84_I	0.529	0.24
109_N	113_I	0.527	0.24
45_A	51_L	0.525	0.24
81_E	123_K	0.524	0.24
22_Y	131_E	0.520	0.24
6_V	22_Y	0.515	0.23
63_L	68_P	0.514	0.23
78_F	81_E	0.513	0.23
40_R	132_Y	0.510	0.23
56_A	76_S	0.510	0.23
107_L	123_K	0.508	0.23
88_T	109_N	0.508	0.23
28_R	45_A	0.507	0.23
51_L	124_L	0.503	0.23
69_D	108_V	0.500	0.23

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3lnoA	1	0.6405	99.9	0.607	Contact Map
3cq1A	2	0.6209	99.9	0.616	Contact Map
1uwdA	1	0.6275	99.9	0.616	Contact Map
3ux2A	2	0.7059	99.9	0.645	Contact Map
1xhjA	1	0.5359	76.3	0.935	Contact Map
2m5oA	1	0.5033	73.2	0.936	Contact Map
1vehA	1	0.5033	63.4	0.941	Contact Map
2qyvA	2	0.9542	44.7	0.947	Contact Map
4tmaI	1	0.2549	44.5	0.947	Contact Map
1ycgA	5	0.8235	42	0.948	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.