Q97YQ3 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97YQ3 - Alanyl-tRNA synthetase truncated homolog (AlaS-like2)

UniProt:	Q97YQ3	Sequences: MDQVEIRTHTALHVVKGAVRKVLGAKWTASTYVNSNHGRLTVKFERKPSDQEMDKVFELANEKVRKNLPIIIEVLPREEAERKYGDEIYDLFLISAEVRELSIVVIPDWSINACNKQHTKFTSEIGEIIKDYWRYRNSKQLLEISFDIKC	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	150 (141)
Sequences:	4446 (2400)
Seq/√Len:	202.1

ECOLI - SYA
BACSU - SYA
HALSA - SYA
SULSO - Q97YQ3 SYA ALAXM

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
67_N	121_F	4.236	1.00
10_T	106_I	3.125	1.00
76_P	79_E	2.942	1.00
63_K	66_K	2.595	1.00
17_G	21_K	2.433	1.00
21_K	59_L	2.422	1.00
77_R	81_E	2.419	1.00
60_A	128_I	2.333	1.00
74_V	100_E	2.325	1.00
119_T	125_I	2.127	1.00
25_A	44_F	2.115	1.00
67_N	123_S	2.109	1.00
46_R	52_E	2.049	1.00
48_P	56_V	2.024	1.00
70_I	106_I	1.957	1.00
120_K	124_E	1.891	1.00
49_S	52_E	1.872	1.00
79_E	82_R	1.845	1.00
22_V	59_L	1.722	1.00
105_V	111_I	1.719	1.00
54_D	58_E	1.713	1.00
73_E	83_K	1.707	1.00
71_I	105_V	1.701	1.00
78_E	82_R	1.700	1.00
3_Q	6_I	1.697	1.00
83_K	111_I	1.691	1.00
55_K	58_E	1.658	1.00
73_E	105_V	1.644	1.00
72_I	104_V	1.623	1.00
59_L	62_E	1.609	1.00
138_S	141_L	1.553	1.00
63_K	109_W	1.537	1.00
7_R	65_R	1.536	1.00
75_L	83_K	1.515	1.00
67_N	124_E	1.509	1.00
48_P	53_M	1.505	1.00
34_N	37_H	1.482	1.00
63_K	68_L	1.460	1.00
69_P	121_F	1.438	1.00
29_A	43_K	1.410	1.00
14_V	60_A	1.404	1.00
20_R	27_W	1.357	1.00
76_P	100_E	1.339	1.00
62_E	66_K	1.293	1.00
20_R	86_D	1.286	1.00
52_E	55_K	1.283	1.00
6_I	117_Q	1.278	1.00
58_E	62_E	1.271	1.00
105_V	108_D	1.263	1.00
133_W	142_L	1.243	1.00
57_F	129_I	1.228	1.00
78_E	81_E	1.196	1.00
59_L	63_K	1.188	1.00
55_K	59_L	1.183	1.00
14_V	63_K	1.182	1.00
64_V	128_I	1.179	1.00
5_E	35_S	1.173	1.00
134_R	145_S	1.155	1.00
53_M	130_K	1.144	1.00
10_T	70_I	1.132	1.00
18_A	59_L	1.121	1.00
12_L	31_T	1.116	1.00
22_V	55_K	1.115	1.00
38_G	146_F	1.105	1.00
4_V	7_R	1.077	1.00
19_V	56_V	1.072	1.00
50_D	54_D	1.068	1.00
75_L	79_E	1.065	1.00
119_T	124_E	1.016	1.00
72_I	102_S	1.010	1.00
37_H	145_S	1.007	1.00
103_I	111_I	1.005	1.00
65_R	127_E	1.002	1.00
12_L	38_G	1.001	1.00
16_K	86_D	1.001	1.00
25_A	45_E	0.998	1.00
70_I	119_T	0.985	1.00
3_Q	7_R	0.980	1.00
17_G	109_W	0.966	0.99
12_L	28_T	0.961	0.99
68_L	107_P	0.951	0.99
4_V	8_T	0.945	0.99
106_I	122_T	0.938	0.99
89_Y	92_F	0.934	0.99
75_L	103_I	0.930	0.99
64_V	125_I	0.922	0.99
11_A	128_I	0.919	0.99
121_F	124_E	0.910	0.99
11_A	125_I	0.890	0.99
51_Q	55_K	0.885	0.99
14_V	125_I	0.875	0.99
96_A	100_E	0.865	0.99
77_R	95_S	0.861	0.99
22_V	52_E	0.843	0.99
21_K	63_K	0.842	0.99
88_I	91_L	0.835	0.99
70_I	104_V	0.831	0.98
15_V	128_I	0.823	0.98
19_V	42_V	0.818	0.98
69_P	120_K	0.814	0.98
48_P	52_E	0.812	0.98
27_W	43_K	0.806	0.98
16_K	88_I	0.806	0.98
131_D	147_D	0.800	0.98
87_E	91_L	0.797	0.98
18_A	22_V	0.796	0.98
61_N	127_E	0.796	0.98
68_L	122_T	0.795	0.98
27_W	86_D	0.793	0.98
21_K	109_W	0.792	0.98
59_L	109_W	0.785	0.98
44_F	52_E	0.781	0.98
14_V	122_T	0.777	0.98
17_G	68_L	0.773	0.98
33_V	38_G	0.754	0.97
14_V	64_V	0.753	0.97
87_E	90_D	0.747	0.97
47_K	136_R	0.746	0.97
28_T	112_N	0.744	0.97
41_T	143_E	0.741	0.97
10_T	119_T	0.739	0.97
83_K	105_V	0.734	0.97
3_Q	124_E	0.730	0.97
17_G	63_K	0.726	0.96
129_I	147_D	0.723	0.96
26_K	43_K	0.720	0.96
17_G	86_D	0.719	0.96
54_D	57_F	0.709	0.96
8_T	38_G	0.708	0.96
6_I	120_K	0.705	0.96
2_D	5_E	0.699	0.96
65_R	123_S	0.698	0.96
29_A	141_L	0.698	0.96
73_E	79_E	0.697	0.95
31_T	38_G	0.693	0.95
6_I	72_I	0.688	0.95
89_Y	93_L	0.678	0.95
95_S	100_E	0.674	0.95
18_A	56_V	0.670	0.94
74_V	95_S	0.655	0.94
15_V	19_V	0.653	0.94
80_A	113_A	0.652	0.94
67_N	122_T	0.648	0.93
123_S	126_G	0.646	0.93
66_K	122_T	0.643	0.93
72_I	120_K	0.639	0.93
20_R	26_K	0.639	0.93
11_A	38_G	0.638	0.93
30_S	41_T	0.638	0.93
130_K	144_I	0.637	0.93
28_T	31_T	0.634	0.93
69_P	107_P	0.633	0.93
15_V	60_A	0.630	0.92
7_R	124_E	0.619	0.92
12_L	146_F	0.618	0.92
12_L	112_N	0.617	0.92
17_G	59_L	0.612	0.91
6_I	119_T	0.610	0.91
48_P	133_W	0.603	0.91
23_L	44_F	0.603	0.91
27_W	46_R	0.602	0.91
70_I	122_T	0.600	0.90
16_K	112_N	0.599	0.90
18_A	109_W	0.599	0.90
72_I	117_Q	0.596	0.90
3_Q	120_K	0.591	0.90
30_S	143_E	0.587	0.89
80_A	84_Y	0.587	0.89
2_D	117_Q	0.583	0.89
75_L	80_A	0.582	0.89
79_E	100_E	0.580	0.89
66_K	69_P	0.580	0.89
68_L	106_I	0.579	0.89
16_K	26_K	0.579	0.89
9_H	13_H	0.574	0.88
14_V	109_W	0.573	0.88
65_R	126_G	0.573	0.88
77_R	80_A	0.570	0.88
45_E	129_I	0.566	0.88
71_I	74_V	0.565	0.88
62_E	69_P	0.565	0.88
47_K	50_D	0.564	0.88
71_I	107_P	0.561	0.87
6_I	124_E	0.561	0.87
27_W	81_E	0.560	0.87
64_V	127_E	0.559	0.87
8_T	33_V	0.555	0.87
25_A	46_R	0.551	0.86
19_V	26_K	0.548	0.86
15_V	38_G	0.542	0.85
80_A	85_G	0.541	0.85
6_I	70_I	0.540	0.85
5_E	8_T	0.540	0.85
23_L	48_P	0.536	0.85
83_K	103_I	0.536	0.85
24_G	44_F	0.535	0.85
75_L	84_Y	0.532	0.84
53_M	133_W	0.532	0.84
81_E	87_E	0.531	0.84
8_T	132_Y	0.526	0.84
90_D	95_S	0.517	0.83
28_T	40_L	0.517	0.83
11_A	146_F	0.516	0.83
26_K	44_F	0.516	0.83
5_E	34_N	0.516	0.83
7_R	119_T	0.512	0.82
32_Y	136_R	0.511	0.82
136_R	139_K	0.510	0.82
77_R	100_E	0.504	0.81
79_E	83_K	0.502	0.81
60_A	63_K	0.502	0.81
51_Q	54_D	0.500	0.81

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2zzeA	1	0.9267	100	0.229	Contact Map
3wqyA	2	0.96	100	0.233	Contact Map
2ztgA	1	0.96	100	0.24	Contact Map
3kewA	1	0.9333	100	0.303	Contact Map
2e1bA	1	0.8267	100	0.329	Contact Map
1v4pA	2	1	100	0.373	Contact Map
1nyrA	2	0.9667	100	0.41	Contact Map
1tkeA	1	0.9667	100	0.425	Contact Map
1qf6A	1	0.9667	100	0.442	Contact Map
4ce4c	1	0.9667	100	0.466	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.