Q97YP5 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97YP5 - Oligo/dipeptide transport, ATP binding protein . carboxy-end. (DppF-2)

UniProt:	Q97YP5	Sequences: MVKHHCRIGVMYLGKVVEIGTPEEVISEPLHPYTQALLQAVPVPDPDIGIKEPNIKGEIQSPLELPKGCVFYSRCPFAKDICKEKPPEIKRIKGDHYVACHLY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	103 (100)
Sequences:	14016 (10263)
Seq/√Len:	1026.3

HALSA - Q9HMI4
SULSO - Q97YP5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
79_K	102_L	3.644	1.00
7_R	19_I	3.037	1.00
9_G	16_V	2.909	1.00
15_K	86_P	2.594	1.00
21_T	24_E	2.333	1.00
72_Y	83_K	2.307	1.00
78_A	83_K	2.287	1.00
81_I	101_H	2.105	1.00
19_I	97_Y	2.078	1.00
20_G	25_V	2.009	1.00
35_Q	77_F	1.972	1.00
81_I	85_K	1.942	1.00
15_K	70_V	1.921	1.00
9_G	19_I	1.837	1.00
39_Q	53_P	1.815	1.00
70_V	86_P	1.736	1.00
15_K	99_A	1.727	1.00
89_I	99_A	1.668	1.00
85_K	101_H	1.633	1.00
91_R	97_Y	1.599	1.00
25_V	34_T	1.557	1.00
36_A	55_I	1.492	1.00
80_D	83_K	1.461	1.00
89_I	97_Y	1.447	1.00
56_K	76_P	1.427	1.00
75_C	82_C	1.405	1.00
72_Y	78_A	1.369	1.00
43_V	46_P	1.369	1.00
35_Q	39_Q	1.356	1.00
69_C	75_C	1.337	1.00
80_D	84_E	1.321	1.00
23_E	27_S	1.320	1.00
67_K	72_Y	1.314	1.00
81_I	102_L	1.302	1.00
77_F	102_L	1.297	1.00
8_I	22_P	1.286	1.00
91_R	94_G	1.284	1.00
65_L	70_V	1.279	1.00
30_L	98_V	1.253	1.00
30_L	92_I	1.223	1.00
69_C	82_C	1.155	1.00
24_E	93_K	1.152	1.00
17_V	70_V	1.133	1.00
87_P	101_H	1.129	1.00
75_C	100_C	1.112	1.00
91_R	95_D	1.107	1.00
24_E	96_H	1.092	1.00
24_E	28_E	1.057	1.00
16_V	19_I	1.051	1.00
69_C	100_C	1.049	1.00
20_G	96_H	1.025	1.00
28_E	93_K	1.013	1.00
5_H	22_P	0.999	1.00
17_V	31_H	0.999	1.00
82_C	100_C	0.978	1.00
55_I	71_F	0.956	1.00
67_K	84_E	0.920	1.00
13_L	59_I	0.919	1.00
62_P	65_L	0.907	1.00
53_P	76_P	0.885	1.00
13_L	62_P	0.882	1.00
13_L	65_L	0.879	1.00
30_L	96_H	0.877	1.00
79_K	101_H	0.867	1.00
19_I	89_I	0.859	1.00
92_I	98_V	0.856	1.00
61_S	64_E	0.854	1.00
32_P	77_F	0.839	1.00
86_P	99_A	0.836	1.00
28_E	96_H	0.821	1.00
26_I	38_L	0.817	1.00
81_I	84_E	0.816	1.00
90_K	101_H	0.803	1.00
66_P	72_Y	0.799	1.00
20_G	24_E	0.780	1.00
36_A	57_G	0.778	1.00
20_G	26_I	0.771	1.00
36_A	71_F	0.769	1.00
43_V	48_I	0.768	1.00
8_I	26_I	0.767	1.00
41_V	44_P	0.764	1.00
52_E	55_I	0.762	1.00
36_A	40_A	0.757	1.00
44_P	48_I	0.752	1.00
39_Q	76_P	0.749	1.00
20_G	29_P	0.742	1.00
24_E	27_S	0.729	1.00
5_H	41_V	0.715	1.00
21_T	95_D	0.708	1.00
36_A	76_P	0.703	1.00
54_N	59_I	0.702	1.00
93_K	96_H	0.702	1.00
30_L	93_K	0.700	1.00
68_G	72_Y	0.689	1.00
79_K	83_K	0.676	1.00
13_L	57_G	0.675	1.00
45_D	48_I	0.667	1.00
35_Q	76_P	0.667	1.00
57_G	60_Q	0.662	1.00
90_K	102_L	0.662	1.00
11_M	17_V	0.660	1.00
24_E	94_G	0.656	1.00
88_E	99_A	0.654	1.00
24_E	95_D	0.649	1.00
38_L	41_V	0.640	1.00
13_L	58_E	0.633	1.00
3_K	26_I	0.632	1.00
66_P	73_S	0.631	1.00
85_K	88_E	0.628	1.00
60_Q	66_P	0.623	1.00
86_P	101_H	0.621	1.00
26_I	29_P	0.619	1.00
61_S	65_L	0.618	1.00
92_I	97_Y	0.607	1.00
13_L	60_Q	0.607	1.00
59_I	73_S	0.603	1.00
22_P	26_I	0.595	1.00
92_I	96_H	0.588	1.00
67_K	83_K	0.585	1.00
29_P	38_L	0.583	1.00
7_R	16_V	0.579	1.00
91_R	96_H	0.579	1.00
10_V	25_V	0.562	1.00
32_P	75_C	0.561	1.00
97_Y	101_H	0.560	1.00
90_K	98_V	0.556	1.00
59_I	62_P	0.556	1.00
46_P	50_I	0.551	1.00
9_G	17_V	0.551	1.00
43_V	47_D	0.550	1.00
39_Q	52_E	0.547	1.00
41_V	45_D	0.545	1.00
73_S	78_A	0.541	1.00
78_A	81_I	0.540	1.00
16_V	89_I	0.537	1.00
64_E	67_K	0.533	1.00
42_P	52_E	0.530	1.00
59_I	70_V	0.526	1.00
98_V	102_L	0.525	1.00
8_I	20_G	0.524	1.00
62_P	66_P	0.523	1.00
88_E	101_H	0.517	1.00
30_L	35_Q	0.514	1.00
4_H	22_P	0.512	1.00
47_D	50_I	0.512	1.00
22_P	25_V	0.512	1.00
51_K	54_N	0.511	1.00
13_L	61_S	0.501	1.00
85_K	90_K	0.501	1.00
15_K	88_E	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4fwiB	1	0.8932	99.9	0.294	Contact Map
3cmwA	1	0.7282	98.8	0.695	Contact Map
3tuiC	2	0.9126	98.2	0.743	Contact Map
3pihA	2	0.3981	98	0.758	Contact Map
2oljA	2	0.4078	97.9	0.761	Contact Map
1b0uA	2	0.4563	97.8	0.765	Contact Map
4ymuJ	2	0.4078	97.8	0.766	Contact Map
4u00A	1	0.4175	97.7	0.775	Contact Map
3zqjA	1	0.3981	97.5	0.78	Contact Map
1oxxK	1	0.8835	97.5	0.781	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.