Q97YN2 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97YN2 - Uncharacterized protein

UniProt:	Q97YN2	Sequences: MKVVIFASSREADMEEPVFCDRDTVKVDASKCTGKGINVAPFIARYLKDLGFHVLVVDPFAEESYYEADEVIKGTTFQIPDDVVKDNYVIVATRHVYDTWAIMKSIYGGAKEIAVIMSLKRAEVILKRLIQAGIDKEKLKKLRIPAGLDIGAKNEKEIAFSIVAEVLAVTRGSMGLPLREIKGFEKLLEKL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	191 (157)
Sequences:	2927 (2077)
Seq/√Len:	165.7

ECOLI - YAGQ YQEB
BACSU - XDHA
SULSO - Q97YN2 Q97UW4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
130_I	136_K	3.338	1.00
103_M	132_A	3.078	1.00
114_A	146_A	2.922	1.00
135_D	138_K	2.886	1.00
160_F	167_L	2.835	1.00
31_K	47_L	2.561	1.00
46_Y	160_F	2.395	1.00
89_V	105_S	2.332	1.00
143_R	165_E	2.318	1.00
84_V	87_N	2.263	1.00
136_K	140_K	2.261	1.00
52_F	167_L	2.188	1.00
30_S	55_L	2.152	1.00
163_V	166_V	2.132	1.00
48_K	69_D	2.112	1.00
46_Y	163_V	2.107	1.00
122_A	126_L	2.014	1.00
47_L	163_V	2.002	1.00
34_G	101_A	1.953	1.00
46_Y	49_D	1.952	1.00
112_E	165_E	1.934	1.00
36_G	58_D	1.861	1.00
127_K	131_Q	1.829	1.00
99_T	128_R	1.827	1.00
45_R	49_D	1.823	1.00
110_A	113_I	1.698	1.00
103_M	107_Y	1.618	1.00
33_T	44_A	1.611	1.00
85_K	109_G	1.582	1.00
89_V	110_A	1.579	1.00
126_L	139_L	1.572	1.00
31_K	166_V	1.562	1.00
103_M	134_I	1.531	1.00
122_A	144_I	1.488	1.00
90_I	146_A	1.454	1.00
102_I	115_V	1.394	1.00
168_A	172_G	1.376	1.00
126_L	130_I	1.375	1.00
138_K	141_K	1.370	1.00
74_G	78_Q	1.364	1.00
152_A	171_R	1.351	1.00
43_I	90_I	1.343	1.00
42_F	156_K	1.337	1.00
50_L	163_V	1.324	1.00
126_L	142_L	1.291	1.00
165_E	168_A	1.280	1.00
143_R	169_V	1.272	1.00
61_A	71_V	1.258	1.00
53_H	70_E	1.251	1.00
59_P	94_R	1.250	1.00
30_S	53_H	1.249	1.00
52_F	88_Y	1.230	1.00
32_C	83_V	1.229	1.00
83_V	89_V	1.226	1.00
110_A	141_K	1.211	1.00
31_K	90_I	1.210	1.00
51_G	156_K	1.199	1.00
105_S	113_I	1.194	1.00
56_V	66_Y	1.190	1.00
120_K	124_V	1.173	1.00
113_I	142_L	1.169	1.00
31_K	88_Y	1.123	1.00
88_Y	170_T	1.121	1.00
39_V	116_I	1.115	1.00
44_A	56_V	1.109	1.00
106_I	134_I	1.095	1.00
50_L	160_F	1.087	1.00
123_E	127_K	1.085	1.00
99_T	132_A	1.081	1.00
115_V	122_A	1.069	0.99
93_T	98_D	1.067	0.99
59_P	97_Y	1.066	0.99
83_V	87_N	1.064	0.99
30_S	87_N	1.063	0.99
43_I	162_I	1.057	0.99
102_I	142_L	1.053	0.99
52_F	170_T	1.052	0.99
108_G	141_K	1.037	0.99
126_L	140_K	1.023	0.99
20_C	23_D	1.011	0.99
39_V	118_S	1.005	0.99
34_G	89_V	0.998	0.99
62_E	65_Y	0.996	0.99
115_V	125_I	0.972	0.99
122_A	142_L	0.967	0.99
88_Y	111_K	0.967	0.99
45_R	67_E	0.949	0.99
44_A	54_V	0.947	0.99
53_H	69_D	0.928	0.99
91_V	102_I	0.927	0.99
42_F	45_R	0.915	0.98
60_F	65_Y	0.913	0.98
77_F	100_W	0.911	0.98
43_I	163_V	0.906	0.98
74_G	80_P	0.906	0.98
95_H	121_R	0.904	0.98
105_S	110_A	0.904	0.98
43_I	92_A	0.898	0.98
107_Y	134_I	0.890	0.98
30_S	84_V	0.889	0.98
32_C	89_V	0.883	0.98
88_Y	112_E	0.878	0.98
99_T	103_M	0.877	0.98
37_I	146_A	0.875	0.98
42_F	46_Y	0.869	0.98
83_V	110_A	0.868	0.98
134_I	138_K	0.866	0.98
137_E	140_K	0.859	0.98
39_V	92_A	0.857	0.98
32_C	87_N	0.857	0.98
31_K	52_F	0.854	0.97
39_V	158_I	0.849	0.97
167_L	171_R	0.849	0.97
29_A	170_T	0.847	0.97
152_A	157_E	0.846	0.97
94_R	117_M	0.845	0.97
32_C	57_V	0.834	0.97
29_A	88_Y	0.834	0.97
28_D	51_G	0.827	0.97
47_L	54_V	0.825	0.97
148_L	161_S	0.818	0.97
32_C	55_L	0.808	0.96
62_E	66_Y	0.807	0.96
107_Y	138_K	0.802	0.96
95_H	99_T	0.801	0.96
47_L	51_G	0.800	0.96
164_A	168_A	0.796	0.96
92_A	118_S	0.787	0.96
115_V	144_I	0.787	0.96
114_A	166_V	0.781	0.96
75_T	78_Q	0.775	0.96
154_N	157_E	0.774	0.96
113_I	134_I	0.765	0.95
121_R	125_I	0.758	0.95
31_K	163_V	0.758	0.95
91_V	105_S	0.749	0.95
149_D	174_M	0.749	0.95
41_P	45_R	0.749	0.95
33_T	40_A	0.749	0.95
95_H	125_I	0.740	0.94
150_I	158_I	0.740	0.94
49_D	156_K	0.737	0.94
33_T	43_I	0.733	0.94
148_L	165_E	0.727	0.94
91_V	115_V	0.719	0.93
55_L	70_E	0.713	0.93
94_R	116_I	0.711	0.93
129_L	139_L	0.709	0.93
74_G	79_I	0.707	0.93
92_A	116_I	0.706	0.93
116_I	146_A	0.704	0.93
20_C	25_V	0.695	0.92
160_F	164_A	0.689	0.92
97_Y	125_I	0.684	0.92
95_H	116_I	0.680	0.91
38_N	121_R	0.678	0.91
58_D	93_T	0.674	0.91
41_P	65_Y	0.673	0.91
55_L	72_I	0.673	0.91
112_E	146_A	0.672	0.91
95_H	128_R	0.670	0.91
91_V	146_A	0.669	0.91
98_D	101_A	0.666	0.91
165_E	169_V	0.664	0.90
104_K	108_G	0.659	0.90
46_Y	156_K	0.657	0.90
149_D	173_S	0.651	0.90
124_V	128_R	0.645	0.89
102_I	113_I	0.645	0.89
157_E	167_L	0.643	0.89
42_F	49_D	0.643	0.89
133_G	139_L	0.643	0.89
157_E	171_R	0.642	0.89
33_T	54_V	0.638	0.89
150_I	157_E	0.637	0.88
123_E	126_L	0.636	0.88
92_A	117_M	0.635	0.88
101_A	121_R	0.632	0.88
20_C	24_T	0.629	0.88
172_G	175_G	0.628	0.88
115_V	121_R	0.628	0.88
121_R	144_I	0.625	0.88
48_K	67_E	0.625	0.88
149_D	175_G	0.624	0.87
39_V	95_H	0.620	0.87
100_W	132_A	0.615	0.87
60_F	94_R	0.615	0.87
46_Y	50_L	0.613	0.87
56_V	71_V	0.612	0.86
166_V	170_T	0.606	0.86
60_F	64_S	0.605	0.86
61_A	65_Y	0.602	0.86
48_K	68_A	0.601	0.85
148_L	151_G	0.599	0.85
130_I	139_L	0.593	0.85
32_C	81_D	0.593	0.85
21_D	27_V	0.582	0.84
92_A	146_A	0.581	0.84
90_I	166_V	0.579	0.83
37_I	95_H	0.573	0.83
114_A	117_M	0.572	0.83
118_S	122_A	0.570	0.82
100_W	103_M	0.569	0.82
69_D	74_G	0.560	0.81
45_R	156_K	0.560	0.81
91_V	98_D	0.560	0.81
26_K	29_A	0.558	0.81
169_V	172_G	0.558	0.81
52_F	171_R	0.556	0.81
94_R	97_Y	0.554	0.81
65_Y	71_V	0.552	0.80
139_L	142_L	0.552	0.80
19_F	22_R	0.547	0.80
98_D	155_E	0.547	0.80
76_T	94_R	0.546	0.80
152_A	158_I	0.541	0.79
22_R	27_V	0.539	0.79
54_V	69_D	0.538	0.79
66_Y	71_V	0.537	0.78
109_G	141_K	0.536	0.78
70_E	73_K	0.536	0.78
39_V	121_R	0.534	0.78
69_D	73_K	0.532	0.78
116_I	144_I	0.531	0.78
60_F	66_Y	0.527	0.77
155_E	167_L	0.522	0.77
124_V	127_K	0.521	0.76
146_A	162_I	0.519	0.76
150_I	161_S	0.519	0.76
106_I	138_K	0.518	0.76
52_F	160_F	0.509	0.75
151_G	172_G	0.508	0.75
100_W	104_K	0.504	0.74
130_I	135_D	0.504	0.74
69_D	72_I	0.504	0.74
86_D	120_K	0.500	0.73

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2we8A	2	0.9005	100	0.151	Contact Map
3on5A	4	0.9372	100	0.256	Contact Map
3fwzA	2	0.6911	96.5	0.876	Contact Map
1id1A	2	0.712	96.1	0.881	Contact Map
3l9wA	2	0.8115	96.1	0.881	Contact Map
2g1uA	2	0.6649	96	0.882	Contact Map
3ic5A	1	0.5759	95.4	0.887	Contact Map
3llvA	2	0.6545	95.3	0.888	Contact Map
3q2oA	2	0.8063	95.2	0.889	Contact Map
1lssA	3	0.644	94.6	0.892	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.