Q97YJ3 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97YJ3 - Uncharacterized protein

UniProt:	Q97YJ3	Sequences: MLFDERPKENREDLFDREKEIKEIMSNINRPLILITGVRRIGKTSVLKVALNEIKIPHVIIDCRNLRPNYSRGDLYSLFSNAFSSKLSTFLDVLSKIRGVSILGNSVELKWKGREYVSLSDLFDHLNEKRIVIGIDEAQKLRGPLSNEIKEAIAHAYDYDKN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	162 (157)
Sequences:	137 (117)
Seq/√Len:	9.3

SULSO - Q97YJ3 Q97YV7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
47_L	134_G	4.914	1.00
6_R	31_P	3.523	0.96
155_H	159_Y	3.494	0.96
63_C	135_I	3.197	0.94
35_I	47_L	2.690	0.86
36_T	44_T	2.433	0.79
48_K	60_I	2.424	0.79
140_K	143_G	2.394	0.78
9_E	48_K	2.368	0.77
22_K	25_M	2.270	0.74
4_D	13_D	2.138	0.70
19_K	133_I	2.008	0.64
155_H	160_D	1.907	0.60
138_A	141_L	1.760	0.54
21_I	50_A	1.745	0.53
44_T	140_K	1.733	0.53
11_R	49_V	1.726	0.52
40_R	158_D	1.718	0.52
48_K	159_Y	1.654	0.49
49_V	133_I	1.629	0.48
29_N	95_S	1.620	0.48
117_V	127_N	1.587	0.46
21_I	49_V	1.552	0.45
18_E	22_K	1.528	0.44
79_F	97_I	1.517	0.43
64_R	154_A	1.502	0.43
154_A	158_D	1.499	0.42
62_D	154_A	1.499	0.42
82_A	85_S	1.496	0.42
4_D	31_P	1.470	0.41
51_L	58_H	1.462	0.41
24_I	50_A	1.457	0.41
123_F	155_H	1.453	0.40
26_S	135_I	1.446	0.40
79_F	126_L	1.437	0.40
4_D	8_K	1.436	0.40
40_R	154_A	1.426	0.39
102_I	133_I	1.413	0.39
61_I	141_L	1.391	0.38
54_I	125_H	1.387	0.38
79_F	149_I	1.375	0.37
8_K	51_L	1.367	0.37
22_K	95_S	1.333	0.35
15_F	41_I	1.332	0.35
17_R	41_I	1.329	0.35
4_D	53_E	1.326	0.35
98_R	108_E	1.314	0.35
2_L	8_K	1.305	0.34
38_V	79_F	1.276	0.33
40_R	62_D	1.262	0.33
67_R	140_K	1.250	0.32
24_I	35_I	1.243	0.32
62_D	158_D	1.237	0.32
11_R	18_E	1.219	0.31
44_T	67_R	1.214	0.31
24_I	157_Y	1.199	0.30
78_L	81_N	1.198	0.30
95_S	121_D	1.185	0.30
62_D	155_H	1.168	0.29
80_S	84_S	1.165	0.29
149_I	157_Y	1.155	0.29
140_K	145_L	1.133	0.28
44_T	124_D	1.132	0.28
4_D	58_H	1.125	0.27
34_L	46_V	1.107	0.27
98_R	115_E	1.106	0.27
28_I	148_E	1.100	0.27
51_L	154_A	1.094	0.26
81_N	97_I	1.088	0.26
60_I	71_S	1.087	0.26
123_F	160_D	1.071	0.26
138_A	158_D	1.065	0.25
49_V	132_V	1.060	0.25
97_I	125_H	1.060	0.25
61_I	109_L	1.044	0.25
3_F	7_P	1.042	0.25
6_R	38_V	1.025	0.24
47_L	53_E	1.015	0.24
32_L	153_I	1.010	0.24
75_L	108_E	1.000	0.23
59_V	118_S	0.996	0.23
15_F	53_E	0.989	0.23
124_D	155_H	0.985	0.23
66_L	112_K	0.984	0.23
35_I	38_V	0.983	0.23
96_K	125_H	0.974	0.22
123_F	133_I	0.964	0.22
67_R	145_L	0.963	0.22
53_E	133_I	0.962	0.22
30_R	126_L	0.957	0.22
38_V	142_R	0.947	0.22
16_D	38_V	0.945	0.22
140_K	144_P	0.944	0.22
141_L	158_D	0.941	0.21
48_K	58_H	0.930	0.21
74_D	87_L	0.927	0.21
83_F	90_F	0.925	0.21
25_M	54_I	0.925	0.21
41_I	49_V	0.925	0.21
2_L	36_T	0.921	0.21
79_F	82_A	0.916	0.21
94_L	149_I	0.916	0.21
117_V	121_D	0.904	0.20
9_E	60_I	0.898	0.20
44_T	65_N	0.896	0.20
144_P	148_E	0.889	0.20
143_G	148_E	0.885	0.20
65_N	138_A	0.881	0.20
103_L	123_F	0.880	0.20
69_N	112_K	0.877	0.20
68_P	71_S	0.869	0.19
30_R	44_T	0.867	0.19
102_I	122_L	0.862	0.19
140_K	151_E	0.858	0.19
156_A	160_D	0.855	0.19
75_L	156_A	0.852	0.19
19_K	89_T	0.845	0.19
32_L	51_L	0.838	0.19
99_G	104_G	0.826	0.18
79_F	99_G	0.823	0.18
11_R	53_E	0.818	0.18
84_S	140_K	0.814	0.18
38_V	41_I	0.808	0.18
60_I	159_Y	0.802	0.18
127_N	141_L	0.802	0.18
31_P	38_V	0.795	0.17
15_F	150_K	0.794	0.17
28_I	90_F	0.794	0.17
110_K	129_K	0.793	0.17
90_F	119_L	0.788	0.17
38_V	82_A	0.787	0.17
29_N	102_I	0.786	0.17
135_I	151_E	0.785	0.17
5_E	31_P	0.785	0.17
64_R	155_H	0.777	0.17
7_P	14_L	0.772	0.17
82_A	123_F	0.772	0.17
14_L	45_S	0.771	0.17
68_P	133_I	0.769	0.17
16_D	34_L	0.764	0.17
64_R	158_D	0.757	0.17
33_I	41_I	0.757	0.17
68_P	159_Y	0.755	0.16
21_I	142_R	0.752	0.16
14_L	49_V	0.750	0.16
12_E	52_N	0.749	0.16
59_V	119_L	0.749	0.16
51_L	142_R	0.748	0.16
67_R	144_P	0.748	0.16
5_E	75_L	0.740	0.16
35_I	133_I	0.737	0.16
107_V	111_W	0.733	0.16
68_P	75_L	0.732	0.16
48_K	133_I	0.727	0.16
8_K	134_G	0.726	0.16
89_T	129_K	0.721	0.16
65_N	124_D	0.720	0.16
38_V	44_T	0.712	0.15
11_R	21_I	0.709	0.15
17_R	85_S	0.704	0.15
69_N	129_K	0.704	0.15
101_S	107_V	0.697	0.15
44_T	76_Y	0.695	0.15
55_K	74_D	0.691	0.15
118_S	127_N	0.688	0.15
68_P	121_D	0.686	0.15
41_I	66_L	0.679	0.15
19_K	23_E	0.675	0.15
21_I	135_I	0.674	0.15
51_L	64_R	0.674	0.15
63_C	138_A	0.666	0.14
66_L	144_P	0.666	0.14
5_E	30_R	0.663	0.14
12_E	135_I	0.662	0.14
31_P	111_W	0.661	0.14
8_K	11_R	0.657	0.14
92_D	95_S	0.652	0.14
155_H	158_D	0.651	0.14
14_L	33_I	0.651	0.14
92_D	122_L	0.646	0.14
102_I	149_I	0.643	0.14
67_R	151_E	0.639	0.14
130_R	149_I	0.639	0.14
11_R	126_L	0.634	0.14
74_D	107_V	0.630	0.14
52_N	57_P	0.628	0.14
27_N	82_A	0.620	0.13
1_M	61_I	0.617	0.13
16_D	154_A	0.616	0.13
17_R	150_K	0.605	0.13
142_R	154_A	0.602	0.13
118_S	146_S	0.600	0.13
65_N	79_F	0.598	0.13
18_E	36_T	0.598	0.13
10_N	110_K	0.596	0.13
51_L	158_D	0.592	0.13
31_P	148_E	0.584	0.13
85_S	120_S	0.579	0.13
10_N	79_F	0.577	0.13
47_L	132_V	0.577	0.13
24_I	118_S	0.571	0.12
112_K	125_H	0.568	0.12
51_L	134_G	0.562	0.12
47_L	142_R	0.562	0.12
49_V	53_E	0.561	0.12
40_R	99_G	0.558	0.12
19_K	103_L	0.557	0.12
38_V	47_L	0.556	0.12
46_V	132_V	0.555	0.12
10_N	89_T	0.555	0.12
18_E	124_D	0.551	0.12
24_I	48_K	0.549	0.12
122_L	131_I	0.548	0.12
76_Y	80_S	0.541	0.12
106_S	121_D	0.540	0.12
52_N	120_S	0.540	0.12
25_M	59_V	0.537	0.12
75_L	115_E	0.534	0.12
23_E	133_I	0.530	0.12
145_L	150_K	0.529	0.12
46_V	107_V	0.528	0.12
79_F	83_F	0.527	0.12
69_N	74_D	0.527	0.12
6_R	157_Y	0.524	0.12
138_A	145_L	0.524	0.12
5_E	124_D	0.519	0.11
26_S	102_I	0.518	0.11
16_D	158_D	0.518	0.11
11_R	25_M	0.513	0.11
16_D	99_G	0.511	0.11
74_D	90_F	0.511	0.11
54_I	59_V	0.510	0.11
82_A	99_G	0.507	0.11
77_S	89_T	0.506	0.11
22_K	33_I	0.503	0.11
10_N	97_I	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2fnaA	1	0.963	99.9	0.556	Contact Map
2qenA	1	0.9321	99.9	0.603	Contact Map
1w5sA	1	0.8519	99.5	0.739	Contact Map
2qbyA	1	0.8457	99.4	0.748	Contact Map
4xgcA	1	0.6667	99.4	0.75	Contact Map
1fnnA	1	0.8272	99.4	0.751	Contact Map
4xgcE	1	0.8395	99.3	0.763	Contact Map
2v1uA	1	0.8395	99.3	0.766	Contact Map
3te6A	1	0.821	99.1	0.783	Contact Map
2qbyB	1	0.8395	99.1	0.784	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.