Q97YJ2 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97YJ2 - Uncharacterized protein

UniProt:	Q97YJ2	Sequences: MGLLHDFLGVEDPGSPLYGRYYFEITLERFDKEKSRQFLRKGFEELSLKVEENVIQDIIAMVDGIPGWLTLAGNQYFNNRDLKRVKDLAINVALNEINSLISVKNNVSPIVAKRYRTVLRCIAKGMNSWSKILNCVQNEEGSTISTSVLSNILNTLKKLSIIDENYRFLDPVYKEASRMLRN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	182 (172)
Sequences:	167 (153)
Seq/√Len:	11.7

SULSO - Q97YJ2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
72_A	76_Y	3.831	0.99
118_V	152_I	3.551	0.98
30_F	66_P	3.520	0.98
101_I	119_L	3.492	0.98
41_K	44_E	3.330	0.97
32_K	60_A	3.250	0.97
54_V	72_A	3.149	0.96
122_I	162_I	3.045	0.96
54_V	76_Y	2.769	0.93
36_R	55_I	2.669	0.91
96_E	100_L	2.647	0.91
6_D	158_K	2.542	0.89
31_D	34_K	2.473	0.88
35_S	63_D	2.453	0.87
72_A	82_L	2.386	0.86
18_Y	149_L	2.206	0.81
85_V	100_L	2.151	0.79
91_N	153_L	2.097	0.77
89_A	100_L	1.941	0.71
89_A	96_E	1.925	0.71
157_K	164_E	1.889	0.69
59_I	63_D	1.865	0.68
119_L	168_F	1.858	0.68
46_L	77_F	1.817	0.66
40_R	44_E	1.730	0.62
133_L	137_Q	1.690	0.60
40_R	52_E	1.648	0.58
20_R	67_G	1.589	0.55
25_I	52_E	1.580	0.55
137_Q	140_E	1.573	0.54
157_K	162_I	1.565	0.54
168_F	173_Y	1.540	0.53
168_F	177_S	1.523	0.52
108_S	112_A	1.508	0.51
132_I	176_A	1.448	0.48
161_I	173_Y	1.437	0.48
30_F	35_S	1.410	0.46
38_F	56_Q	1.340	0.43
173_Y	177_S	1.337	0.43
108_S	111_V	1.304	0.41
9_G	12_D	1.297	0.41
40_R	81_D	1.290	0.41
57_D	84_R	1.279	0.40
17_L	129_W	1.278	0.40
53_N	84_R	1.255	0.39
118_V	149_L	1.248	0.39
48_L	61_M	1.248	0.39
37_Q	41_K	1.246	0.38
132_I	165_N	1.241	0.38
127_N	160_S	1.239	0.38
13_P	66_P	1.233	0.38
37_Q	165_N	1.230	0.38
7_F	17_L	1.213	0.37
118_V	164_E	1.209	0.37
36_R	56_Q	1.207	0.37
76_Y	82_L	1.204	0.36
51_E	158_K	1.203	0.36
18_Y	80_R	1.187	0.36
27_L	30_F	1.186	0.36
114_R	152_I	1.156	0.34
155_T	162_I	1.152	0.34
4_L	7_F	1.145	0.34
58_I	72_A	1.110	0.32
57_D	60_A	1.095	0.32
162_I	169_L	1.094	0.32
54_V	82_L	1.087	0.31
70_T	74_N	1.084	0.31
68_W	129_W	1.082	0.31
62_V	125_G	1.075	0.31
149_L	157_K	1.037	0.29
154_N	158_K	1.030	0.29
51_E	154_N	1.027	0.29
100_L	146_T	1.022	0.29
29_R	169_L	1.021	0.29
140_E	176_A	1.015	0.28
3_L	149_L	1.009	0.28
70_T	103_V	1.008	0.28
27_L	66_P	1.002	0.28
136_V	141_G	1.000	0.28
34_K	37_Q	0.996	0.28
31_D	91_N	0.989	0.27
1_M	57_D	0.988	0.27
19_G	38_F	0.988	0.27
2_G	18_Y	0.984	0.27
48_L	77_F	0.981	0.27
89_A	165_N	0.971	0.27
108_S	140_E	0.966	0.26
37_Q	45_E	0.965	0.26
37_Q	87_D	0.964	0.26
50_V	155_T	0.952	0.26
29_R	161_I	0.952	0.26
45_E	129_W	0.952	0.26
2_G	171_P	0.945	0.26
4_L	160_S	0.940	0.25
133_L	146_T	0.940	0.25
51_E	147_S	0.940	0.25
62_V	161_I	0.935	0.25
70_T	89_A	0.933	0.25
28_E	41_K	0.927	0.25
101_I	158_K	0.922	0.25
83_K	86_K	0.920	0.25
43_F	50_V	0.913	0.24
130_S	176_A	0.913	0.24
37_Q	163_D	0.912	0.24
30_F	64_G	0.900	0.24
92_V	95_N	0.888	0.23
95_N	133_L	0.886	0.23
18_Y	151_N	0.879	0.23
41_K	45_E	0.872	0.23
130_S	162_I	0.859	0.22
93_A	100_L	0.854	0.22
19_G	69_L	0.854	0.22
62_V	173_Y	0.843	0.22
52_E	60_A	0.838	0.22
44_E	49_K	0.837	0.22
27_L	85_V	0.830	0.21
32_K	36_R	0.830	0.21
60_A	145_S	0.826	0.21
84_R	117_T	0.825	0.21
14_G	60_A	0.820	0.21
129_W	133_L	0.817	0.21
81_D	89_A	0.817	0.21
76_Y	81_D	0.816	0.21
47_S	53_N	0.813	0.21
51_E	87_D	0.811	0.21
7_F	155_T	0.810	0.21
57_D	61_M	0.809	0.21
97_I	173_Y	0.808	0.21
63_D	66_P	0.806	0.21
31_D	36_R	0.804	0.21
121_C	135_C	0.800	0.21
25_I	28_E	0.796	0.20
82_L	85_V	0.795	0.20
35_S	125_G	0.790	0.20
78_N	116_R	0.788	0.20
25_I	128_S	0.785	0.20
8_L	33_E	0.769	0.20
56_Q	153_L	0.767	0.19
75_Q	78_N	0.764	0.19
70_T	146_T	0.763	0.19
48_L	137_Q	0.760	0.19
19_G	68_W	0.756	0.19
83_K	165_N	0.754	0.19
90_I	96_E	0.745	0.19
85_V	162_I	0.745	0.19
48_L	142_S	0.739	0.19
41_K	154_N	0.738	0.19
5_H	159_L	0.738	0.19
57_D	86_K	0.733	0.18
79_N	175_E	0.723	0.18
90_I	93_A	0.723	0.18
71_L	92_V	0.721	0.18
81_D	87_D	0.720	0.18
51_E	91_N	0.719	0.18
71_L	174_K	0.718	0.18
10_V	120_R	0.718	0.18
150_S	162_I	0.715	0.18
114_R	129_W	0.715	0.18
29_R	138_N	0.713	0.18
157_K	169_L	0.706	0.18
14_G	81_D	0.705	0.18
18_Y	163_D	0.704	0.18
36_R	113_K	0.693	0.17
97_I	172_V	0.692	0.17
85_V	89_A	0.690	0.17
50_V	103_V	0.690	0.17
41_K	139_E	0.689	0.17
145_S	168_F	0.686	0.17
57_D	83_K	0.684	0.17
92_V	112_A	0.682	0.17
19_G	129_W	0.677	0.17
46_L	58_I	0.676	0.17
133_L	164_E	0.675	0.17
9_G	14_G	0.674	0.17
44_E	51_E	0.672	0.17
135_C	139_E	0.671	0.17
3_L	89_A	0.670	0.17
20_R	115_Y	0.666	0.17
97_I	165_N	0.666	0.17
37_Q	61_M	0.664	0.16
120_R	124_K	0.663	0.16
78_N	113_K	0.663	0.16
15_S	29_R	0.655	0.16
25_I	87_D	0.647	0.16
6_D	121_C	0.638	0.16
99_S	128_S	0.637	0.16
50_V	61_M	0.636	0.16
113_K	130_S	0.634	0.16
126_M	131_K	0.634	0.16
44_E	98_N	0.634	0.16
95_N	98_N	0.630	0.16
22_Y	155_T	0.626	0.15
25_I	34_K	0.624	0.15
72_A	85_V	0.624	0.15
36_R	44_E	0.622	0.15
57_D	82_L	0.621	0.15
51_E	56_Q	0.616	0.15
5_H	26_T	0.614	0.15
43_F	170_D	0.613	0.15
8_L	115_Y	0.613	0.15
30_F	63_D	0.604	0.15
111_V	159_L	0.602	0.15
174_K	177_S	0.601	0.15
123_A	151_N	0.600	0.15
19_G	100_L	0.598	0.15
128_S	155_T	0.597	0.15
36_R	40_R	0.596	0.15
132_I	144_I	0.596	0.15
91_N	97_I	0.595	0.15
38_F	64_G	0.594	0.15
67_G	115_Y	0.591	0.15
19_G	170_D	0.578	0.14
85_V	96_E	0.577	0.14
2_G	160_S	0.577	0.14
3_L	72_A	0.577	0.14
58_I	62_V	0.577	0.14
1_M	120_R	0.576	0.14
10_V	149_L	0.576	0.14
13_P	45_E	0.573	0.14
76_Y	79_N	0.573	0.14
14_G	132_I	0.572	0.14
45_E	141_G	0.565	0.14
7_F	122_I	0.562	0.14
17_L	45_E	0.561	0.14
57_D	167_R	0.558	0.14
47_S	60_A	0.558	0.14
89_A	92_V	0.557	0.14
7_F	10_V	0.555	0.14
15_S	18_Y	0.555	0.14
51_E	84_R	0.554	0.14
54_V	85_V	0.553	0.14
26_T	147_S	0.553	0.14
80_R	169_L	0.552	0.14
3_L	132_I	0.535	0.13
32_K	56_Q	0.534	0.13
14_G	79_N	0.533	0.13
21_Y	141_G	0.533	0.13
83_K	87_D	0.529	0.13
157_K	163_D	0.524	0.13
40_R	175_E	0.523	0.13
78_N	162_I	0.521	0.13
120_R	123_A	0.520	0.13
114_R	144_I	0.519	0.13
82_L	100_L	0.519	0.13
101_I	140_E	0.518	0.13
15_S	45_E	0.517	0.13
91_N	95_N	0.516	0.13
90_I	162_I	0.514	0.13
76_Y	162_I	0.513	0.13
97_I	161_I	0.512	0.13
39_L	64_G	0.512	0.13
137_Q	141_G	0.511	0.13
16_P	114_R	0.508	0.13
60_A	98_N	0.508	0.13
111_V	148_V	0.508	0.13
39_L	166_Y	0.504	0.13
10_V	162_I	0.504	0.13
29_R	155_T	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2fnaA	1	0.9615	99.9	0.652	Contact Map
2qenA	1	0.956	99.9	0.667	Contact Map
1w5sA	1	0.9945	98.2	0.86	Contact Map
3pfiA	3	0.9176	97.7	0.876	Contact Map
1hqcA	1	0.9176	97.6	0.878	Contact Map
1fnnA	1	0.9725	97.3	0.884	Contact Map
4xgcA	1	0.8846	97.2	0.885	Contact Map
1z6tA	1	0.9615	96.9	0.89	Contact Map
2qbyA	1	0.9286	96.1	0.9	Contact Map
2qbyB	1	0.9451	96	0.901	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.