Q97YI6 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97YI6 - First ORF in transposon ISC1904

UniProt:	Q97YI6	Sequences: MLRSKEACQRLGISYATLREYVKKGYIKPVILQSGKWRFREEDVERLMGIIRKRKVILYARVSSSTQKDDLANQVKYLEEQVKEYDQVITDIGSGLNMKRKGFLKLLRMILNNEVSRVVIAYPDRLVRFGFEILEEVCKAHGCEIVVINQEDKEEELVEDLVSILLSFSGKLHGMRSHKYEKVKKCAEELKA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	192 (182)
Sequences:	478 (336)
Seq/√Len:	24.9

SULSO - Q97YI6 Q97XB5 Q97XI0 Q97U52 Q97YH2 Q97U67 Q97YU0 Q97YX0 Q97UQ9 Q97XQ1 Q97XZ4 Q97X40 Q97Z60 Q97X25 Q97WZ6 Q97Y49

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
56_V	117_R	4.228	1.00
60_A	78_L	4.175	1.00
82_V	119_V	3.708	1.00
117_R	144_E	3.514	1.00
7_A	11_L	2.774	0.99
103_F	126_L	2.671	0.99
58_L	148_I	2.659	0.99
110_I	138_C	2.612	0.99
13_I	21_Y	2.369	0.98
17_T	21_Y	2.330	0.98
91_D	102_G	2.309	0.98
135_E	139_K	2.256	0.97
85_Y	146_V	2.183	0.97
16_A	19_R	2.140	0.96
106_L	115_V	2.137	0.96
18_L	39_F	2.053	0.96
5_K	9_Q	2.030	0.95
22_V	37_W	1.988	0.95
55_K	109_M	1.972	0.94
98_M	132_E	1.962	0.94
96_L	129_F	1.918	0.94
111_L	141_H	1.907	0.93
75_V	90_T	1.837	0.92
77_Y	121_A	1.828	0.92
58_L	88_V	1.812	0.91
58_L	78_L	1.747	0.90
131_F	145_I	1.739	0.90
22_V	29_P	1.689	0.88
3_R	34_S	1.680	0.88
119_V	132_E	1.656	0.87
138_C	143_C	1.650	0.87
110_I	115_V	1.649	0.87
87_Q	109_M	1.635	0.86
131_F	147_V	1.620	0.86
89_I	102_G	1.607	0.85
110_I	118_V	1.572	0.84
127_V	131_F	1.512	0.82
98_M	167_S	1.503	0.81
4_S	19_R	1.498	0.81
166_L	177_S	1.495	0.81
109_M	114_E	1.490	0.81
75_V	88_V	1.484	0.81
110_I	120_I	1.470	0.80
12_G	142_G	1.469	0.80
155_E	159_E	1.463	0.80
40_R	43_D	1.455	0.79
119_V	146_V	1.455	0.79
72_A	76_K	1.436	0.78
138_C	172_L	1.398	0.76
16_A	24_K	1.354	0.74
70_D	73_N	1.346	0.73
26_Y	33_Q	1.339	0.73
122_Y	159_E	1.332	0.73
96_L	130_G	1.326	0.72
4_S	18_L	1.306	0.71
7_A	44_V	1.281	0.70
166_L	170_G	1.255	0.68
167_S	170_G	1.253	0.68
27_I	30_V	1.248	0.68
7_A	27_I	1.240	0.67
15_Y	19_R	1.234	0.67
17_T	20_E	1.231	0.67
31_I	37_W	1.209	0.65
170_G	175_M	1.193	0.64
121_A	178_H	1.187	0.64
22_V	27_I	1.187	0.64
8_C	15_Y	1.175	0.63
56_V	144_E	1.155	0.61
62_V	67_Q	1.151	0.61
64_S	67_Q	1.147	0.61
131_F	134_L	1.142	0.61
91_D	167_S	1.139	0.60
22_V	39_F	1.137	0.60
67_Q	70_D	1.135	0.60
57_I	75_V	1.134	0.60
91_D	121_A	1.132	0.60
8_C	13_I	1.122	0.59
89_I	118_V	1.112	0.58
20_E	23_K	1.107	0.58
58_L	82_V	1.106	0.58
78_L	148_I	1.089	0.57
95_G	126_L	1.071	0.56
117_R	146_V	1.062	0.55
159_E	170_G	1.060	0.55
89_I	106_L	1.045	0.54
76_K	79_E	1.045	0.54
14_S	20_E	1.041	0.53
3_R	38_R	1.039	0.53
173_H	176_R	1.033	0.53
62_V	71_L	1.023	0.52
72_A	75_V	1.002	0.51
56_V	119_V	0.994	0.50
14_S	172_L	0.989	0.50
27_I	134_L	0.980	0.49
8_C	171_K	0.979	0.49
138_C	169_S	0.975	0.49
75_V	107_L	0.969	0.48
170_G	177_S	0.962	0.48
8_C	18_L	0.958	0.47
28_K	43_D	0.954	0.47
129_F	160_D	0.954	0.47
4_S	29_P	0.948	0.47
148_I	154_E	0.947	0.47
171_K	175_M	0.947	0.47
98_M	127_V	0.946	0.47
127_V	134_L	0.939	0.46
156_E	168_F	0.935	0.46
19_R	39_F	0.915	0.44
161_L	165_L	0.914	0.44
57_I	89_I	0.906	0.44
164_I	174_G	0.905	0.44
22_V	31_I	0.902	0.43
77_Y	149_N	0.897	0.43
13_I	20_E	0.895	0.43
108_R	140_A	0.895	0.43
139_K	171_K	0.894	0.43
157_L	166_L	0.890	0.43
7_A	38_R	0.889	0.42
181_E	185_K	0.885	0.42
19_R	22_V	0.883	0.42
11_L	18_L	0.882	0.42
95_G	103_F	0.870	0.41
4_S	15_Y	0.861	0.41
158_V	161_L	0.857	0.40
7_A	18_L	0.855	0.40
134_L	138_C	0.847	0.40
26_Y	34_S	0.845	0.39
166_L	178_H	0.844	0.39
56_V	93_G	0.842	0.39
85_Y	148_I	0.841	0.39
4_S	7_A	0.824	0.38
30_V	38_R	0.817	0.37
110_I	143_C	0.817	0.37
157_L	160_D	0.811	0.37
63_S	67_Q	0.811	0.37
81_Q	146_V	0.808	0.37
27_I	43_D	0.807	0.37
43_D	46_R	0.806	0.37
54_R	143_C	0.795	0.36
18_L	22_V	0.793	0.36
118_V	183_V	0.784	0.35
48_M	108_R	0.778	0.35
67_Q	73_N	0.773	0.35
93_G	163_S	0.768	0.34
19_R	31_I	0.760	0.34
81_Q	85_Y	0.756	0.33
19_R	36_K	0.751	0.33
42_E	73_N	0.746	0.33
78_L	143_C	0.744	0.33
121_A	166_L	0.740	0.32
177_S	183_V	0.737	0.32
3_R	33_Q	0.736	0.32
73_N	162_V	0.735	0.32
118_V	145_I	0.731	0.32
50_I	116_S	0.725	0.31
39_F	43_D	0.723	0.31
55_K	87_Q	0.720	0.31
54_R	142_G	0.719	0.31
6_E	43_D	0.714	0.31
100_R	127_V	0.713	0.31
9_Q	68_K	0.709	0.30
63_S	128_R	0.709	0.30
10_R	90_T	0.708	0.30
30_V	43_D	0.701	0.30
56_V	116_S	0.694	0.30
89_I	109_M	0.694	0.30
6_E	157_L	0.692	0.29
119_V	134_L	0.688	0.29
160_D	174_G	0.684	0.29
85_Y	121_A	0.682	0.29
103_F	127_V	0.682	0.29
5_K	34_S	0.679	0.29
97_N	141_H	0.676	0.28
155_E	158_V	0.676	0.28
44_V	118_V	0.672	0.28
13_I	31_I	0.671	0.28
48_M	51_I	0.668	0.28
68_K	179_K	0.664	0.28
120_I	147_V	0.664	0.28
33_Q	113_N	0.661	0.28
157_L	168_F	0.661	0.28
19_R	37_W	0.661	0.28
92_I	145_I	0.656	0.27
96_L	133_I	0.656	0.27
91_D	145_I	0.656	0.27
57_I	106_L	0.652	0.27
160_D	164_I	0.650	0.27
77_Y	178_H	0.647	0.27
14_S	22_V	0.644	0.27
77_Y	163_S	0.643	0.27
64_S	73_N	0.640	0.26
149_N	153_K	0.638	0.26
54_R	112_N	0.636	0.26
123_P	165_L	0.632	0.26
70_D	121_A	0.631	0.26
129_F	164_I	0.628	0.26
107_L	146_V	0.627	0.26
147_V	165_L	0.625	0.26
92_I	100_R	0.620	0.25
6_E	146_V	0.620	0.25
119_V	136_E	0.616	0.25
177_S	180_Y	0.613	0.25
81_Q	149_N	0.612	0.25
161_L	164_I	0.607	0.25
84_E	119_V	0.604	0.24
92_I	101_K	0.604	0.24
161_L	174_G	0.603	0.24
55_K	116_S	0.600	0.24
29_P	39_F	0.599	0.24
129_F	174_G	0.599	0.24
77_Y	91_D	0.596	0.24
107_L	111_L	0.594	0.24
64_S	174_G	0.591	0.24
137_V	140_A	0.590	0.24
91_D	98_M	0.589	0.24
118_V	147_V	0.589	0.24
103_F	167_S	0.588	0.24
35_G	90_T	0.583	0.23
169_S	175_M	0.581	0.23
23_K	101_K	0.579	0.23
8_C	12_G	0.576	0.23
6_E	57_I	0.574	0.23
101_K	165_L	0.573	0.23
81_Q	148_I	0.569	0.23
82_V	85_Y	0.569	0.23
36_K	39_F	0.566	0.22
69_D	164_I	0.566	0.22
8_C	103_F	0.565	0.22
130_G	169_S	0.565	0.22
93_G	144_E	0.563	0.22
34_S	113_N	0.559	0.22
73_N	76_K	0.558	0.22
57_I	115_V	0.558	0.22
110_I	147_V	0.557	0.22
12_G	129_F	0.553	0.22
91_D	111_L	0.552	0.22
5_K	19_R	0.552	0.22
142_G	161_L	0.551	0.22
66_T	121_A	0.548	0.22
134_L	157_L	0.546	0.21
56_V	87_Q	0.543	0.21
23_K	31_I	0.542	0.21
104_L	136_E	0.541	0.21
120_I	145_I	0.539	0.21
32_L	36_K	0.538	0.21
31_I	36_K	0.537	0.21
124_D	128_R	0.537	0.21
57_I	150_Q	0.534	0.21
22_V	34_S	0.532	0.21
103_F	116_S	0.530	0.21
130_G	146_V	0.529	0.21
45_E	48_M	0.529	0.21
161_L	168_F	0.528	0.21
15_Y	37_W	0.526	0.21
99_K	141_H	0.525	0.20
6_E	32_L	0.521	0.20
28_K	35_G	0.518	0.20
153_K	175_M	0.514	0.20
13_I	38_R	0.509	0.20
5_K	8_C	0.509	0.20
63_S	129_F	0.508	0.20
29_P	43_D	0.508	0.20
22_V	32_L	0.508	0.20
76_K	80_E	0.508	0.20
118_V	126_L	0.507	0.20
44_V	85_Y	0.507	0.20
66_T	122_Y	0.506	0.20
178_H	184_K	0.505	0.20
31_I	40_R	0.504	0.20
115_V	143_C	0.502	0.19
110_I	145_I	0.502	0.19
32_L	41_E	0.501	0.19
135_E	145_I	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ilxA	2	0.7188	100	0.65	Contact Map
3lhkA	2	0.7292	100	0.652	Contact Map
3g13A	2	0.7292	99.8	0.731	Contact Map
3bvpA	4	0.625	99.8	0.74	Contact Map
3guvA	2	0.6875	99.8	0.74	Contact Map
4bqqA	2	0.6979	99.8	0.741	Contact Map
2mhcA	1	0.5625	99.8	0.742	Contact Map
2gm5A	4	0.6302	99.8	0.751	Contact Map
1gdtA	2	0.6875	99.7	0.757	Contact Map
3pkzA	4	0.5833	99.7	0.761	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0077 seconds.