Q97YH9 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97YH9 - Uncharacterized protein

UniProt:	Q97YH9	Sequences: MKMSLAEEIKKVLKENPSIIVDALAQRPEILYDVLVKLMPWQVIIRDIDDLKNHTQKIEKELGEVKESLKNFVTKEDAKNFATKDDIKRLETIITGLGARWGLLSEDAFRQGVYEIMKSEGIVAKKELVYDKTGEVYGEPSDVEYDLMIEDGNLVMIEITSAIKRGDLPVIRKKKEFYERNKNVKISKVIVITPFLHDKYPDRLKAMAKDMGIEIINP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	218 (189)
Sequences:	127 (120)
Seq/√Len:	8.8

SULSO - Q97YH9 Q97UQ7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
164_K	167_D	3.800	0.97
75_K	78_A	3.355	0.94
71_N	74_T	3.227	0.93
179_E	185_K	3.192	0.92
37_K	41_W	2.549	0.80
50_D	54_H	2.374	0.75
145_Y	156_M	2.372	0.75
55_T	58_I	2.320	0.73
97_L	194_P	2.272	0.72
64_E	67_E	2.190	0.69
69_L	72_F	2.155	0.67
74_T	78_A	2.136	0.67
68_S	73_V	2.126	0.66
184_V	187_S	2.090	0.65
175_K	189_V	2.066	0.64
69_L	73_V	2.060	0.64
186_I	189_V	1.899	0.57
89_R	179_E	1.892	0.57
44_I	48_I	1.876	0.56
98_G	101_W	1.824	0.54
206_A	209_K	1.814	0.54
172_R	176_E	1.808	0.53
42_Q	46_R	1.803	0.53
51_L	55_T	1.752	0.51
113_V	116_I	1.736	0.50
64_E	68_S	1.732	0.50
50_D	53_N	1.718	0.50
57_K	60_K	1.697	0.49
80_N	84_K	1.640	0.46
130_Y	210_D	1.615	0.45
36_V	39_M	1.615	0.45
61_E	66_K	1.605	0.45
43_V	48_I	1.599	0.44
82_A	85_D	1.598	0.44
35_L	38_L	1.589	0.44
111_Q	114_Y	1.575	0.43
68_S	72_F	1.535	0.42
168_L	191_V	1.523	0.41
115_E	216_I	1.506	0.41
37_K	40_P	1.475	0.39
97_L	196_L	1.472	0.39
58_I	62_L	1.462	0.39
130_Y	156_M	1.439	0.38
65_V	69_L	1.405	0.36
67_E	70_K	1.392	0.36
175_K	186_I	1.378	0.35
68_S	71_N	1.375	0.35
83_T	87_I	1.371	0.35
108_A	196_L	1.347	0.34
149_I	157_I	1.345	0.34
61_E	67_E	1.345	0.34
68_S	74_T	1.323	0.33
46_R	49_D	1.322	0.33
72_F	76_E	1.313	0.33
60_K	63_G	1.308	0.33
30_I	40_P	1.302	0.32
139_E	180_R	1.298	0.32
109_F	178_Y	1.296	0.32
160_T	164_K	1.291	0.32
118_K	214_E	1.291	0.32
26_Q	40_P	1.284	0.32
27_R	40_P	1.276	0.31
27_R	30_I	1.270	0.31
155_V	190_I	1.261	0.31
107_D	165_R	1.259	0.31
73_V	76_E	1.255	0.31
175_K	184_V	1.252	0.31
30_I	39_M	1.242	0.30
26_Q	30_I	1.236	0.30
26_Q	38_L	1.234	0.30
76_E	83_T	1.230	0.30
112_G	215_I	1.226	0.30
44_I	51_L	1.182	0.28
101_W	161_S	1.175	0.28
71_N	75_K	1.168	0.28
70_K	77_D	1.164	0.27
32_Y	36_V	1.157	0.27
61_E	70_K	1.152	0.27
175_K	187_S	1.151	0.27
104_L	114_Y	1.139	0.27
42_Q	53_N	1.132	0.26
51_L	58_I	1.120	0.26
80_N	85_D	1.116	0.26
110_R	173_K	1.109	0.26
110_R	178_Y	1.100	0.25
60_K	64_E	1.097	0.25
168_L	207_M	1.087	0.25
65_V	68_S	1.080	0.25
129_V	154_L	1.077	0.25
80_N	83_T	1.076	0.25
126_K	157_I	1.052	0.24
119_S	143_V	1.048	0.24
117_M	174_K	1.045	0.24
81_F	85_D	1.039	0.23
27_R	31_L	1.034	0.23
153_N	187_S	1.034	0.23
62_L	65_V	1.028	0.23
154_L	186_I	1.028	0.23
76_E	79_K	1.028	0.23
57_K	188_K	1.025	0.23
111_Q	177_F	1.022	0.23
30_I	37_K	1.021	0.23
50_D	64_E	1.005	0.22
140_P	178_Y	0.999	0.22
38_L	41_W	0.988	0.22
28_P	32_Y	0.986	0.22
82_A	87_I	0.985	0.22
189_V	206_A	0.981	0.22
129_V	181_N	0.976	0.22
109_F	173_K	0.970	0.21
56_Q	60_K	0.969	0.21
62_L	67_E	0.957	0.21
28_P	40_P	0.952	0.21
46_R	60_K	0.952	0.21
27_R	37_K	0.952	0.21
136_V	178_Y	0.949	0.21
110_R	140_P	0.948	0.21
130_Y	140_P	0.944	0.21
76_E	80_N	0.938	0.20
187_S	215_I	0.935	0.20
78_A	189_V	0.928	0.20
109_F	194_P	0.918	0.20
65_V	73_V	0.915	0.20
114_Y	152_G	0.910	0.20
113_V	137_Y	0.904	0.20
114_Y	187_S	0.897	0.19
63_G	67_E	0.894	0.19
35_L	40_P	0.892	0.19
84_K	87_I	0.891	0.19
73_V	78_A	0.887	0.19
35_L	42_Q	0.887	0.19
105_S	173_K	0.875	0.19
126_K	144_E	0.869	0.19
68_S	75_K	0.861	0.18
128_L	145_Y	0.861	0.18
42_Q	56_Q	0.858	0.18
29_E	180_R	0.856	0.18
45_I	48_I	0.851	0.18
168_L	197_H	0.850	0.18
171_I	189_V	0.850	0.18
163_I	191_V	0.846	0.18
31_L	43_V	0.837	0.18
54_H	59_E	0.835	0.18
25_A	30_I	0.831	0.18
193_T	196_L	0.829	0.18
133_T	180_R	0.820	0.17
114_Y	177_F	0.819	0.17
32_Y	45_I	0.816	0.17
31_L	40_P	0.815	0.17
96_G	105_S	0.800	0.17
82_A	86_D	0.799	0.17
47_D	52_K	0.798	0.17
136_V	173_K	0.792	0.17
54_H	61_E	0.787	0.17
163_I	207_M	0.786	0.17
120_E	157_I	0.786	0.17
156_M	186_I	0.786	0.17
187_S	196_L	0.782	0.16
196_L	204_L	0.779	0.16
92_T	99_A	0.779	0.16
45_I	59_E	0.777	0.16
105_S	184_V	0.774	0.16
108_A	114_Y	0.770	0.16
36_V	45_I	0.762	0.16
103_L	180_R	0.760	0.16
145_Y	184_V	0.755	0.16
80_N	87_I	0.754	0.16
74_T	77_D	0.745	0.16
155_V	175_K	0.742	0.16
111_Q	159_I	0.738	0.15
90_L	183_N	0.734	0.15
32_Y	37_K	0.732	0.15
52_K	59_E	0.730	0.15
133_T	187_S	0.721	0.15
53_N	123_V	0.719	0.15
46_R	67_E	0.718	0.15
107_D	206_A	0.716	0.15
61_E	64_E	0.715	0.15
37_K	42_Q	0.713	0.15
136_V	140_P	0.713	0.15
32_Y	35_L	0.710	0.15
161_S	214_E	0.706	0.15
45_I	121_G	0.698	0.15
58_I	65_V	0.697	0.15
188_K	214_E	0.695	0.14
28_P	33_D	0.693	0.14
93_I	159_I	0.691	0.14
145_Y	189_V	0.690	0.14
98_G	194_P	0.690	0.14
124_A	173_K	0.688	0.14
66_K	69_L	0.688	0.14
108_A	125_K	0.687	0.14
109_F	155_V	0.687	0.14
29_E	85_D	0.684	0.14
27_R	39_M	0.683	0.14
61_E	68_S	0.681	0.14
34_V	45_I	0.678	0.14
148_M	157_I	0.675	0.14
106_E	131_D	0.672	0.14
124_A	188_K	0.671	0.14
92_T	118_K	0.671	0.14
107_D	157_I	0.667	0.14
86_D	91_E	0.666	0.14
105_S	110_R	0.664	0.14
28_P	31_L	0.664	0.14
76_E	84_K	0.663	0.14
65_V	72_F	0.657	0.14
156_M	172_R	0.656	0.14
112_G	178_Y	0.654	0.14
107_D	111_Q	0.653	0.14
169_P	207_M	0.650	0.14
29_E	41_W	0.649	0.14
103_L	116_I	0.648	0.14
97_L	193_T	0.646	0.13
97_L	108_A	0.645	0.13
57_K	61_E	0.644	0.13
129_V	132_K	0.637	0.13
33_D	66_K	0.632	0.13
103_L	183_N	0.632	0.13
70_K	73_V	0.629	0.13
129_V	182_K	0.628	0.13
90_L	111_Q	0.625	0.13
28_P	34_V	0.617	0.13
41_W	44_I	0.615	0.13
136_V	177_F	0.614	0.13
34_V	40_P	0.609	0.13
169_P	184_V	0.608	0.13
110_R	136_V	0.604	0.13
122_I	129_V	0.604	0.13
163_I	167_D	0.601	0.13
67_E	71_N	0.601	0.13
197_H	203_R	0.600	0.13
103_L	140_P	0.596	0.13
38_L	63_G	0.593	0.12
113_V	171_I	0.590	0.12
63_G	66_K	0.589	0.12
144_E	174_K	0.588	0.12
68_S	76_E	0.582	0.12
46_R	53_N	0.582	0.12
66_K	70_K	0.582	0.12
123_V	137_Y	0.580	0.12
35_L	45_I	0.578	0.12
57_K	62_L	0.573	0.12
145_Y	210_D	0.570	0.12
71_N	78_A	0.569	0.12
196_L	217_N	0.568	0.12
30_I	41_W	0.565	0.12
48_I	51_L	0.565	0.12
113_V	129_V	0.564	0.12
194_P	216_I	0.563	0.12
57_K	160_T	0.563	0.12
97_L	147_L	0.561	0.12
177_F	183_N	0.558	0.12
196_L	215_I	0.554	0.12
41_W	45_I	0.552	0.12
90_L	181_N	0.551	0.12
173_K	178_Y	0.548	0.12
156_M	185_K	0.547	0.12
180_R	203_R	0.547	0.12
92_T	217_N	0.546	0.12
43_V	47_D	0.545	0.12
168_L	206_A	0.544	0.12
48_I	53_N	0.539	0.11
59_E	63_G	0.537	0.11
183_N	205_K	0.536	0.11
139_E	217_N	0.535	0.11
76_E	143_V	0.532	0.11
33_D	37_K	0.532	0.11
71_N	77_D	0.524	0.11
63_G	128_L	0.524	0.11
102_G	131_D	0.524	0.11
102_G	106_E	0.524	0.11
69_L	74_T	0.522	0.11
32_Y	40_P	0.517	0.11
96_G	140_P	0.515	0.11
38_L	45_I	0.515	0.11
68_S	114_Y	0.514	0.11
104_L	108_A	0.508	0.11
43_V	46_R	0.508	0.11
114_Y	118_K	0.507	0.11
26_Q	31_L	0.506	0.11
186_I	206_A	0.502	0.11
155_V	194_P	0.500	0.11
117_M	186_I	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1y88A	5	0.4725	95.2	0.917	Contact Map
1xmxA	2	0.9312	95	0.917	Contact Map
2inbA	2	0.4404	83.1	0.937	Contact Map
2wcwA	2	0.4266	79.3	0.939	Contact Map
2dfsA	2	0.5413	67	0.945	Contact Map
2vldA	2	0.6514	64.9	0.946	Contact Map
2bnxA	2	0.2294	55.8	0.949	Contact Map
1m0dA	2	0.4541	52.2	0.95	Contact Map
2eo0A	2	0.3945	50.1	0.95	Contact Map
1ob8A	1	0.3945	49.9	0.951	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.