Q97YG9 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97YG9 - Transcriptional regulator, marR family, putative

UniProt:	Q97YG9	Sequences: MQKIDEKLQLMNTIAKIYRGSIKEFNNRLGKLMNLSYLDFSILKATSEEPRSMVYLANRYFVTQSAITAAVDKLEAKGLVRRIRDSKDRRIVIVEITPKGRQVLLEANEVLRNLVNEMLSDVENVEELLEGLNKILSRIGSSKD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	144 (129)
Sequences:	20990 (15436)
Seq/√Len:	1359.1

ECOLI - SLYA MPRA MARR
BACSU - YXAD YDCH YSMB OHRR YFIV YUSO YYBA YWAE YETL YCGE MHQR YKOM YDGJ YPOP YDGG YWHA YWOH YHJH YVMB YVNA YBFA
SULSO - Q97YG9 Q97Z53

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
50_P	95_E	3.238	1.00
83_I	95_E	3.161	1.00
124_N	134_K	3.066	1.00
81_R	95_E	2.580	1.00
85_D	93_I	2.577	1.00
52_S	91_I	2.541	1.00
127_E	130_E	2.273	1.00
127_E	131_G	2.186	1.00
47_S	104_L	2.157	1.00
84_R	92_V	2.038	1.00
52_S	55_Y	2.008	1.00
39_D	77_K	1.887	1.00
85_D	91_I	1.831	1.00
124_N	127_E	1.818	1.00
50_P	93_I	1.806	1.00
121_D	138_R	1.772	1.00
47_S	96_I	1.670	1.00
122_V	131_G	1.640	1.00
99_K	103_V	1.621	1.00
53_M	71_V	1.621	1.00
50_P	83_I	1.571	1.00
78_G	99_K	1.570	1.00
71_V	94_V	1.557	1.00
36_S	39_D	1.550	1.00
39_D	73_K	1.549	1.00
124_N	130_E	1.502	1.00
42_I	70_A	1.501	1.00
72_D	76_A	1.498	1.00
99_K	102_Q	1.474	1.00
128_L	131_G	1.471	1.00
131_G	134_K	1.458	1.00
13_T	133_N	1.438	1.00
32_L	110_V	1.433	1.00
103_V	106_E	1.422	1.00
75_E	82_R	1.388	1.00
47_S	101_R	1.353	1.00
72_D	89_R	1.330	1.00
45_A	59_R	1.318	1.00
17_I	136_L	1.306	1.00
28_R	110_V	1.275	1.00
13_T	136_L	1.247	1.00
13_T	129_L	1.241	1.00
55_Y	58_N	1.237	1.00
54_V	64_Q	1.209	1.00
102_Q	106_E	1.196	1.00
62_V	66_A	1.193	1.00
130_E	134_K	1.174	1.00
63_T	66_A	1.162	1.00
53_M	92_V	1.159	1.00
32_L	106_E	1.154	1.00
53_M	94_V	1.123	1.00
54_V	58_N	1.117	1.00
26_N	30_G	1.106	1.00
123_E	127_E	1.094	1.00
42_I	67_I	1.092	1.00
49_E	101_R	1.071	1.00
28_R	117_E	1.063	1.00
53_M	67_I	1.059	1.00
125_V	129_L	1.057	1.00
16_K	136_L	1.049	1.00
79_L	103_V	1.043	1.00
129_L	133_N	1.042	1.00
51_R	59_R	1.037	1.00
51_R	55_Y	1.033	1.00
110_V	113_N	1.003	1.00
34_N	77_K	1.003	1.00
77_K	99_K	1.001	1.00
72_D	75_E	0.999	1.00
77_K	103_V	0.996	1.00
98_P	101_R	0.991	1.00
124_N	131_G	0.991	1.00
96_I	100_G	0.989	1.00
68_T	72_D	0.968	1.00
62_V	67_I	0.968	1.00
17_I	132_L	0.937	1.00
101_R	105_L	0.936	1.00
65_S	68_T	0.925	1.00
71_V	80_V	0.910	1.00
66_A	69_A	0.909	1.00
82_R	92_V	0.903	1.00
84_R	89_R	0.901	1.00
69_A	73_K	0.900	1.00
98_P	102_Q	0.893	1.00
28_R	113_N	0.887	1.00
53_M	64_Q	0.886	1.00
115_V	118_M	0.886	1.00
127_E	134_K	0.883	1.00
47_S	105_L	0.877	1.00
15_A	18_Y	0.875	1.00
55_Y	59_R	0.875	1.00
46_T	80_V	0.874	1.00
38_L	70_A	0.870	1.00
49_E	95_E	0.869	1.00
63_T	69_A	0.869	1.00
43_L	104_L	0.869	1.00
81_R	97_T	0.863	1.00
111_L	115_V	0.863	1.00
18_Y	22_I	0.862	1.00
86_S	93_I	0.858	1.00
83_I	93_I	0.855	1.00
109_E	113_N	0.849	1.00
10_L	129_L	0.841	1.00
75_E	81_R	0.837	1.00
28_R	114_L	0.835	1.00
20_G	136_L	0.829	1.00
71_V	75_E	0.827	1.00
40_F	107_A	0.825	1.00
79_L	99_K	0.818	1.00
88_D	91_I	0.807	1.00
113_N	116_N	0.789	1.00
19_R	23_K	0.788	1.00
14_I	18_Y	0.787	1.00
41_S	60_Y	0.774	1.00
96_I	101_R	0.773	1.00
114_L	117_E	0.762	1.00
42_I	56_L	0.761	1.00
113_N	117_E	0.760	1.00
126_E	129_L	0.758	1.00
47_S	108_N	0.757	1.00
126_E	130_E	0.756	1.00
85_D	88_D	0.752	1.00
45_A	60_Y	0.750	1.00
42_I	60_Y	0.746	1.00
122_V	135_I	0.740	1.00
69_A	72_D	0.729	1.00
106_E	110_V	0.723	1.00
123_E	126_E	0.711	1.00
45_A	51_R	0.711	1.00
31_K	110_V	0.710	1.00
38_L	66_A	0.704	1.00
39_D	70_A	0.704	1.00
109_E	112_R	0.704	1.00
26_N	37_Y	0.702	1.00
53_M	68_T	0.698	1.00
46_T	51_R	0.696	1.00
75_E	80_V	0.695	1.00
117_E	120_S	0.694	1.00
102_Q	105_L	0.693	1.00
45_A	56_L	0.692	1.00
24_E	117_E	0.686	1.00
40_F	111_L	0.681	1.00
73_K	76_A	0.678	1.00
112_R	116_N	0.674	1.00
24_E	114_L	0.667	1.00
133_N	137_S	0.665	1.00
32_L	107_A	0.664	1.00
74_L	79_L	0.661	1.00
108_N	112_R	0.648	1.00
72_D	82_R	0.647	1.00
106_E	109_E	0.641	1.00
57_A	64_Q	0.635	1.00
57_A	67_I	0.633	1.00
28_R	31_K	0.632	1.00
14_I	17_I	0.630	1.00
134_K	138_R	0.627	1.00
15_A	19_R	0.626	1.00
17_I	135_I	0.624	1.00
131_G	138_R	0.613	1.00
119_L	125_V	0.608	1.00
22_I	26_N	0.604	1.00
67_I	71_V	0.597	1.00
46_T	96_I	0.597	1.00
122_V	134_K	0.595	1.00
25_F	111_L	0.592	1.00
13_T	16_K	0.590	1.00
56_L	94_V	0.587	1.00
105_L	108_N	0.587	1.00
43_L	47_S	0.585	1.00
24_E	27_N	0.577	1.00
40_F	104_L	0.571	1.00
25_F	28_R	0.571	1.00
22_I	25_F	0.569	1.00
83_I	86_S	0.567	1.00
44_K	104_L	0.567	1.00
78_G	81_R	0.555	1.00
44_K	108_N	0.546	1.00
105_L	109_E	0.544	1.00
130_E	133_N	0.542	1.00
16_K	20_G	0.541	1.00
122_V	125_V	0.537	1.00
44_K	48_E	0.536	1.00
41_S	45_A	0.534	1.00
14_I	132_L	0.526	1.00
53_M	91_I	0.520	1.00
27_N	30_G	0.518	1.00
120_S	138_R	0.517	1.00
20_G	24_E	0.517	1.00
84_R	88_D	0.509	1.00
73_K	77_K	0.507	1.00
131_G	135_I	0.507	1.00
35_L	103_V	0.504	1.00
27_N	31_K	0.501	1.00
23_K	27_N	0.500	1.00
10_L	128_L	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3f3xA	2	0.9653	99.9	0.251	Contact Map
3deuA	2	0.8889	99.9	0.273	Contact Map
3cjnA	2	0.9792	99.9	0.273	Contact Map
3cdhA	4	0.8958	99.9	0.276	Contact Map
3e6mA	2	0.9792	99.9	0.281	Contact Map
3u2rA	4	0.8889	99.9	0.282	Contact Map
3zplA	2	0.9931	99.9	0.283	Contact Map
4rguA	4	0.9722	99.9	0.285	Contact Map
2fbkA	2	0.9097	99.9	0.286	Contact Map
3boqA	2	0.9167	99.9	0.289	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.