Q97YG5 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97YG5 - Dolichyl-phosphate mannose synthase related protein

UniProt:	Q97YG5	Sequences: MLYKYYRSSPKILLLLTCKESLKMISVIIPAFNEERRIGKTLEKISSTLPNAEVVVVFDGHDNTPEVVKKFPVKLIISKERLGKGMALKRGITESNFQRVLLLDADFPITEEELNKILSTDADLVIPRRKIIGMPLKRRFLHKAFIVLTKILFPSLLKFSDFQAGVKLVNREKVVSVLDELIINDFLFDVNLIYAFKRRHYKIKEVEINYIHDESDSKISRGSVLKQS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	228 (191)
Sequences:	46667 (38611)
Seq/√Len:	2793.8

ECOLI - YIBD ARNC WCAA GTRB WBBL WCAE PGAC YAIP
BACSU - CGED EPSJ GGAA EPSH CSBB YKCC EPSE GGAB YKOT TUAG SPSA YWDF YFNE YDAM TAGF
HALSA - Q9HQP8 Q9HNK3 Q9HQP4 Q9HSC8 Q9HR08 Q9HQQ6 Q9HQP3 Q9HSB1
SULSO - Q97YG5 Q97X05 Q97TZ0 Q7LXF7 Q7LXG6 Q97YM4 Q97TY0 Q97WK7 Q97W52 Q7LXY2 Q97UK7 Q97YN4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
171_R	175_V	3.259	1.00
34_E	105_A	3.187	1.00
35_E	63_N	2.842	1.00
26_S	97_F	2.509	1.00
58_F	77_I	2.415	1.00
191_N	195_A	2.390	1.00
31_A	64_T	2.359	1.00
90_R	94_E	2.292	1.00
65_P	69_K	2.169	1.00
116_K	208_I	2.101	1.00
122_A	204_K	2.050	1.00
28_I	91_G	2.031	1.00
53_E	74_K	1.995	1.00
57_V	91_G	1.969	1.00
63_N	66_E	1.966	1.00
24_M	98_Q	1.946	1.00
39_G	43_E	1.940	1.00
88_L	104_D	1.933	1.00
29_I	54_V	1.894	1.00
173_K	201_Y	1.857	1.00
26_S	53_E	1.849	1.00
39_G	71_F	1.847	1.00
40_K	108_P	1.836	1.00
84_K	88_L	1.777	1.00
65_P	77_I	1.774	1.00
78_S	90_R	1.772	1.00
76_I	94_E	1.772	1.00
82_L	86_M	1.744	1.00
35_E	67_V	1.739	1.00
39_G	67_V	1.721	1.00
117_I	168_L	1.705	1.00
65_P	75_L	1.701	1.00
99_R	168_L	1.697	1.00
101_L	168_L	1.679	1.00
25_I	118_L	1.674	1.00
113_E	117_I	1.674	1.00
109_I	113_E	1.662	1.00
56_V	68_V	1.635	1.00
123_D	170_N	1.629	1.00
43_E	71_F	1.602	1.00
24_M	51_N	1.589	1.00
29_I	41_T	1.574	1.00
32_F	81_R	1.560	1.00
74_K	94_E	1.511	1.00
31_A	56_V	1.487	1.00
39_G	70_K	1.468	1.00
69_K	77_I	1.449	1.00
33_N	61_H	1.437	1.00
53_E	97_F	1.431	1.00
90_R	93_T	1.427	1.00
88_L	102_L	1.413	1.00
76_I	90_R	1.408	1.00
85_G	188_F	1.399	1.00
31_A	34_E	1.399	1.00
49_L	118_L	1.393	1.00
112_E	116_K	1.381	1.00
101_L	114_L	1.373	1.00
43_E	47_S	1.367	1.00
93_T	179_D	1.338	1.00
92_I	174_V	1.336	1.00
110_T	211_I	1.332	1.00
103_L	109_I	1.330	1.00
59_D	81_R	1.300	1.00
101_L	113_E	1.297	1.00
34_E	37_R	1.285	1.00
116_K	119_S	1.282	1.00
176_S	199_R	1.278	1.00
176_S	201_Y	1.275	1.00
115_N	119_S	1.274	1.00
26_S	95_S	1.265	1.00
172_E	176_S	1.254	1.00
68_V	75_L	1.253	1.00
123_D	201_Y	1.244	1.00
79_K	82_L	1.239	1.00
100_V	171_R	1.238	1.00
67_V	71_F	1.218	1.00
31_A	105_A	1.214	1.00
58_F	78_S	1.213	1.00
25_I	114_L	1.192	1.00
42_L	71_F	1.188	1.00
67_V	70_K	1.181	1.00
24_M	97_F	1.174	1.00
49_L	52_A	1.156	1.00
167_K	193_I	1.146	1.00
173_K	196_F	1.140	1.00
58_F	65_P	1.131	1.00
181_L	184_N	1.127	1.00
40_K	213_D	1.126	1.00
26_S	55_V	1.125	1.00
117_I	127_P	1.114	1.00
95_S	171_R	1.112	1.00
79_K	90_R	1.106	1.00
98_Q	170_N	1.103	1.00
92_I	102_L	1.093	1.00
84_K	188_F	1.086	1.00
86_M	182_I	1.083	1.00
172_E	175_V	1.074	1.00
63_N	67_V	1.061	1.00
42_L	54_V	1.059	1.00
124_L	203_I	1.056	1.00
57_V	87_A	1.053	1.00
53_E	96_N	1.044	1.00
170_N	173_K	1.040	1.00
46_S	72_P	1.024	1.00
25_I	168_L	1.023	1.00
44_K	109_I	1.021	1.00
124_L	196_F	0.996	1.00
66_E	69_K	0.987	1.00
92_I	100_V	0.979	1.00
30_P	87_A	0.975	1.00
84_K	164_A	0.973	1.00
78_S	82_L	0.961	1.00
41_T	103_L	0.958	1.00
86_M	90_R	0.956	1.00
78_S	87_A	0.951	1.00
54_V	73_V	0.946	1.00
66_E	70_K	0.935	1.00
101_L	109_I	0.934	1.00
74_K	96_N	0.929	1.00
181_L	191_N	0.927	1.00
84_K	104_D	0.922	1.00
47_S	111_E	0.920	1.00
93_T	180_E	0.920	1.00
45_I	54_V	0.916	1.00
24_M	96_N	0.914	1.00
88_L	188_F	0.904	1.00
116_K	206_V	0.903	1.00
42_L	56_V	0.903	1.00
43_E	46_S	0.903	1.00
45_I	103_L	0.900	1.00
128_R	205_E	0.897	1.00
59_D	87_A	0.893	1.00
112_E	115_N	0.890	1.00
129_R	165_G	0.883	1.00
174_V	192_L	0.879	1.00
27_V	45_I	0.879	1.00
46_S	71_F	0.875	1.00
65_P	78_S	0.838	1.00
123_D	202_K	0.838	1.00
79_K	86_M	0.828	1.00
44_K	108_P	0.825	1.00
130_K	209_N	0.823	1.00
113_E	127_P	0.818	1.00
178_L	181_L	0.807	1.00
27_V	101_L	0.794	1.00
121_D	202_K	0.785	1.00
59_D	82_L	0.784	1.00
130_K	211_I	0.783	1.00
40_K	43_E	0.780	1.00
110_T	113_E	0.778	1.00
99_R	118_L	0.776	1.00
117_I	125_V	0.761	1.00
42_L	46_S	0.754	1.00
57_V	90_R	0.750	1.00
31_A	38_I	0.748	1.00
89_K	93_T	0.747	1.00
46_S	73_V	0.746	1.00
31_A	68_V	0.739	1.00
52_A	114_L	0.738	1.00
118_L	168_L	0.736	1.00
30_P	105_A	0.733	1.00
52_A	72_P	0.732	1.00
85_G	89_K	0.726	1.00
75_L	78_S	0.725	1.00
177_V	199_R	0.725	1.00
92_I	95_S	0.724	1.00
196_F	201_Y	0.720	1.00
164_A	167_K	0.716	1.00
99_R	170_N	0.715	1.00
59_D	83_G	0.714	1.00
108_P	211_I	0.711	1.00
134_M	137_K	0.708	1.00
23_K	98_Q	0.707	1.00
55_V	94_E	0.707	1.00
82_L	87_A	0.705	1.00
128_R	207_E	0.705	1.00
113_E	166_V	0.700	1.00
30_P	88_L	0.699	1.00
38_I	67_V	0.697	1.00
44_K	112_E	0.696	1.00
69_K	78_S	0.692	1.00
33_N	58_F	0.689	1.00
61_H	64_T	0.686	1.00
137_K	140_F	0.685	1.00
87_A	104_D	0.685	1.00
95_S	100_V	0.683	1.00
35_E	39_G	0.683	1.00
38_I	105_A	0.682	1.00
177_V	196_F	0.681	1.00
147_V	151_I	0.680	1.00
113_E	116_K	0.680	1.00
41_T	44_K	0.679	1.00
60_G	81_R	0.678	1.00
110_T	130_K	0.674	1.00
84_K	87_A	0.674	1.00
210_Y	213_D	0.672	1.00
27_V	114_L	0.667	1.00
55_V	91_G	0.663	1.00
128_R	131_I	0.662	1.00
48_T	115_N	0.661	1.00
122_A	126_I	0.656	1.00
69_K	75_L	0.652	1.00
98_Q	172_E	0.650	1.00
45_I	109_I	0.648	1.00
32_F	59_D	0.647	1.00
145_F	149_T	0.645	1.00
25_I	101_L	0.644	1.00
38_I	68_V	0.641	1.00
65_P	68_V	0.640	1.00
138_R	141_L	0.638	1.00
169_V	174_V	0.635	1.00
55_V	74_K	0.634	1.00
29_I	105_A	0.630	1.00
58_F	61_H	0.630	1.00
32_F	60_G	0.629	1.00
136_L	140_F	0.628	1.00
173_K	176_S	0.625	1.00
87_A	90_R	0.625	1.00
123_D	173_K	0.622	1.00
117_I	166_V	0.619	1.00
187_L	190_V	0.617	1.00
35_E	66_E	0.612	1.00
41_T	45_I	0.609	1.00
173_K	177_V	0.607	1.00
132_I	136_L	0.607	1.00
137_K	141_L	0.602	1.00
26_S	96_N	0.601	1.00
192_L	196_F	0.601	1.00
206_V	209_N	0.598	1.00
169_V	193_I	0.597	1.00
78_S	81_R	0.592	1.00
100_V	174_V	0.588	1.00
144_A	147_V	0.587	1.00
56_V	73_V	0.586	1.00
169_V	192_L	0.585	1.00
148_L	151_I	0.583	1.00
122_A	125_V	0.582	1.00
120_T	204_K	0.580	1.00
104_D	188_F	0.579	1.00
30_P	59_D	0.576	1.00
84_K	189_D	0.575	1.00
102_L	169_V	0.575	1.00
29_I	45_I	0.572	1.00
40_K	44_K	0.570	1.00
51_N	72_P	0.570	1.00
190_V	194_Y	0.570	1.00
24_M	118_L	0.567	1.00
120_T	123_D	0.566	1.00
44_K	211_I	0.566	1.00
49_L	115_N	0.566	1.00
151_I	154_P	0.566	1.00
169_V	196_F	0.565	1.00
50_P	115_N	0.564	1.00
101_L	166_V	0.562	1.00
89_K	180_E	0.561	1.00
33_N	64_T	0.560	1.00
139_R	143_K	0.560	1.00
123_D	172_E	0.559	1.00
108_P	213_D	0.556	1.00
109_I	114_L	0.549	1.00
37_R	40_K	0.545	1.00
29_I	56_V	0.542	1.00
55_V	95_S	0.541	1.00
149_T	153_F	0.537	1.00
28_I	57_V	0.537	1.00
24_M	49_L	0.536	1.00
102_L	180_E	0.536	1.00
37_R	41_T	0.533	1.00
179_D	192_L	0.533	1.00
136_L	139_R	0.531	1.00
82_L	90_R	0.531	1.00
123_D	127_P	0.530	1.00
84_K	102_L	0.529	1.00
126_I	205_E	0.525	1.00
24_M	52_A	0.523	1.00
24_M	53_E	0.521	1.00
23_K	49_L	0.517	1.00
86_M	183_I	0.514	1.00
27_V	52_A	0.512	1.00
126_I	129_R	0.512	1.00
174_V	179_D	0.505	1.00
48_T	112_E	0.503	1.00
173_K	200_H	0.503	1.00
122_A	202_K	0.502	1.00
35_E	38_I	0.500	1.00
41_T	107_F	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3l7iA	4	0	100	0.343	Contact Map
3bcvA	2	0.7412	100	0.349	Contact Map
1qg8A	1	0.8202	100	0.353	Contact Map
2z86A	2	0.9649	100	0.356	Contact Map
1xhbA	1	0.9561	100	0.361	Contact Map
2d7iA	1	1	100	0.368	Contact Map
5ajoA	1	1	100	0.378	Contact Map
4fixA	3	0.9956	100	0.393	Contact Map
3ckjA	2	0.9518	100	0.394	Contact Map
2bo4A	4	0.864	100	0.427	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0085 seconds.