Q97YE3 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97YE3 - Uncharacterized protein

UniProt:	Q97YE3	Sequences: MESQLPKFLKEPEKYSRLRLLEALQELYLSIEMLKEGYSRNSASKLFLSWKALLSSIVVTNFGKIMETKKKEGKEDEIKWYMRIGYSAPTTGLIGIARDLENLGFKGLVNLTTAMLGIHRYAYNGLDEDISPFHSRSEAIISIKGLIKAEVEIVGSMKFGDEEKELFEKIKRELNNI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	177 (149)
Sequences:	162 (128)
Seq/√Len:	10.5

SULSO - Q97YE3 Q7LXG9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
133_F	142_S	4.996	1.00
54_L	93_L	4.378	0.99
50_W	112_T	3.926	0.99
88_A	96_I	3.738	0.98
47_F	90_T	3.583	0.98
126_L	139_A	3.457	0.97
32_E	36_E	3.285	0.96
121_Y	139_A	3.169	0.95
85_G	93_L	2.552	0.86
120_R	132_P	2.524	0.86
121_Y	126_L	2.508	0.85
113_T	117_G	2.319	0.80
121_Y	136_R	2.206	0.77
11_E	14_K	2.194	0.76
62_F	82_M	2.193	0.76
50_W	139_A	2.155	0.75
58_V	88_A	2.067	0.72
58_V	96_I	2.055	0.71
31_I	151_V	2.031	0.70
112_T	146_L	1.900	0.65
19_R	43_A	1.897	0.65
136_R	139_A	1.872	0.64
55_S	88_A	1.850	0.63
118_I	142_S	1.703	0.56
44_S	122_A	1.696	0.56
50_W	146_L	1.667	0.54
94_I	142_S	1.599	0.51
24_L	154_V	1.558	0.49
95_G	135_S	1.538	0.48
20_L	144_K	1.478	0.46
139_A	146_L	1.471	0.45
53_L	108_L	1.426	0.43
4_Q	128_E	1.336	0.39
39_S	121_Y	1.323	0.38
65_I	81_Y	1.320	0.38
151_V	154_V	1.318	0.38
14_K	17_R	1.318	0.38
26_E	34_L	1.316	0.38
60_T	81_Y	1.312	0.38
94_I	133_F	1.291	0.37
55_S	96_I	1.285	0.37
147_I	154_V	1.284	0.37
82_M	147_I	1.280	0.37
126_L	136_R	1.255	0.35
27_L	143_I	1.242	0.35
112_T	139_A	1.241	0.35
42_S	48_L	1.216	0.34
30_S	127_D	1.161	0.32
54_L	90_T	1.157	0.31
90_T	93_L	1.154	0.31
101_E	106_K	1.152	0.31
40_R	131_S	1.116	0.30
84_I	137_S	1.115	0.30
31_I	77_E	1.108	0.29
50_W	126_L	1.100	0.29
126_L	140_I	1.080	0.28
64_K	67_E	1.080	0.28
61_N	64_K	1.058	0.28
103_L	150_E	1.047	0.27
40_R	43_A	1.029	0.26
49_S	137_S	1.025	0.26
46_L	97_A	1.020	0.26
140_I	144_K	1.005	0.26
94_I	117_G	1.004	0.26
30_S	42_S	0.998	0.25
150_E	153_I	0.968	0.24
76_D	130_I	0.966	0.24
16_S	60_T	0.965	0.24
15_Y	56_S	0.953	0.24
71_K	105_F	0.952	0.24
100_L	146_L	0.948	0.24
33_M	86_Y	0.944	0.23
12_P	59_V	0.944	0.23
39_S	136_R	0.942	0.23
107_G	153_I	0.934	0.23
33_M	83_R	0.929	0.23
8_F	55_S	0.924	0.23
51_K	137_S	0.920	0.23
5_L	121_Y	0.920	0.23
26_E	48_L	0.909	0.22
44_S	65_I	0.906	0.22
52_A	118_I	0.901	0.22
105_F	146_L	0.894	0.22
117_G	132_P	0.888	0.22
134_H	152_E	0.864	0.21
53_L	98_R	0.862	0.21
85_G	103_L	0.850	0.20
51_K	71_K	0.839	0.20
115_M	137_S	0.839	0.20
21_L	70_K	0.836	0.20
5_L	8_F	0.829	0.20
83_R	120_R	0.826	0.20
41_N	51_K	0.822	0.20
86_Y	105_F	0.819	0.20
94_I	98_R	0.814	0.19
28_Y	38_Y	0.809	0.19
70_K	93_L	0.801	0.19
33_M	38_Y	0.801	0.19
19_R	65_I	0.799	0.19
126_L	134_H	0.793	0.19
50_W	121_Y	0.790	0.19
69_K	86_Y	0.785	0.19
63_G	108_L	0.784	0.19
16_S	29_L	0.782	0.18
80_W	138_E	0.776	0.18
34_L	52_A	0.774	0.18
92_G	117_G	0.772	0.18
16_S	78_I	0.769	0.18
41_N	142_S	0.765	0.18
92_G	134_H	0.762	0.18
102_N	113_T	0.755	0.18
28_Y	83_R	0.754	0.18
70_K	154_V	0.751	0.18
13_E	93_L	0.749	0.18
66_M	82_M	0.743	0.17
31_I	147_I	0.743	0.17
108_L	151_V	0.733	0.17
25_Q	128_E	0.728	0.17
102_N	141_I	0.726	0.17
78_I	138_E	0.725	0.17
45_K	157_M	0.721	0.17
18_L	128_E	0.716	0.17
91_T	147_I	0.714	0.17
48_L	58_V	0.706	0.16
29_L	132_P	0.694	0.16
17_R	105_F	0.690	0.16
25_Q	28_Y	0.690	0.16
81_Y	120_R	0.687	0.16
49_S	122_A	0.684	0.16
62_F	81_Y	0.680	0.16
19_R	22_E	0.679	0.16
70_K	148_K	0.675	0.16
30_S	150_E	0.675	0.16
120_R	144_K	0.671	0.16
54_L	100_L	0.666	0.15
58_V	104_G	0.665	0.15
80_W	104_G	0.663	0.15
6_P	104_G	0.661	0.15
41_N	45_K	0.661	0.15
5_L	104_G	0.655	0.15
149_A	152_E	0.655	0.15
12_P	47_F	0.653	0.15
24_L	147_I	0.651	0.15
95_G	107_G	0.650	0.15
103_L	157_M	0.644	0.15
75_E	151_V	0.644	0.15
11_E	17_R	0.637	0.15
149_A	153_I	0.637	0.15
27_L	38_Y	0.637	0.15
31_I	144_K	0.636	0.15
118_I	132_P	0.631	0.15
40_R	44_S	0.627	0.14
54_L	57_I	0.621	0.14
18_L	126_L	0.621	0.14
31_I	47_F	0.619	0.14
92_G	146_L	0.619	0.14
40_R	48_L	0.617	0.14
66_M	135_S	0.615	0.14
32_E	46_L	0.610	0.14
11_E	86_Y	0.607	0.14
112_T	145_G	0.606	0.14
51_K	101_E	0.605	0.14
107_G	114_A	0.603	0.14
28_Y	77_E	0.603	0.14
48_L	131_S	0.600	0.14
62_F	85_G	0.600	0.14
7_K	49_S	0.599	0.14
18_L	84_I	0.598	0.14
79_K	83_R	0.597	0.14
6_P	50_W	0.596	0.14
59_V	62_F	0.595	0.14
44_S	48_L	0.593	0.14
48_L	122_A	0.593	0.14
69_K	95_G	0.593	0.14
101_E	109_V	0.593	0.14
34_L	91_T	0.592	0.14
129_D	134_H	0.591	0.14
28_Y	96_I	0.588	0.14
52_A	63_G	0.583	0.13
77_E	143_I	0.583	0.13
8_F	122_A	0.582	0.13
118_I	143_I	0.581	0.13
53_L	142_S	0.578	0.13
90_T	128_E	0.576	0.13
17_R	84_I	0.575	0.13
78_I	83_R	0.575	0.13
64_K	104_G	0.573	0.13
13_E	20_L	0.570	0.13
110_N	113_T	0.568	0.13
47_F	93_L	0.568	0.13
111_L	138_E	0.567	0.13
94_I	104_G	0.567	0.13
94_I	114_A	0.566	0.13
51_K	120_R	0.566	0.13
11_E	69_K	0.564	0.13
56_S	90_T	0.561	0.13
150_E	157_M	0.555	0.13
33_M	54_L	0.552	0.13
51_K	107_G	0.552	0.13
23_A	30_S	0.550	0.13
143_I	154_V	0.548	0.13
14_K	21_L	0.547	0.13
96_I	154_V	0.547	0.13
94_I	113_T	0.546	0.13
80_W	129_D	0.543	0.13
137_S	144_K	0.542	0.13
41_N	49_S	0.538	0.13
71_K	133_F	0.537	0.13
4_Q	78_I	0.533	0.12
96_I	132_P	0.529	0.12
22_E	40_R	0.528	0.12
67_E	124_N	0.528	0.12
63_G	79_K	0.528	0.12
14_K	108_L	0.528	0.12
26_E	42_S	0.527	0.12
110_N	114_A	0.525	0.12
145_G	156_S	0.522	0.12
26_E	139_A	0.516	0.12
71_K	83_R	0.514	0.12
70_K	103_L	0.510	0.12
23_A	55_S	0.506	0.12
17_R	97_A	0.503	0.12
30_S	155_G	0.502	0.12
44_S	131_S	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4j4wA	3	0.435	78.4	0.937	Contact Map
2hsbA	2	0.6836	78.2	0.938	Contact Map
3o10A	2	0.7345	78	0.938	Contact Map
4j4rA	3	0.4576	69	0.942	Contact Map
2jpuA	1	0.7232	68.6	0.942	Contact Map
1wolA	1	0.6554	61.5	0.945	Contact Map
4j4yA	4	0.4407	57.8	0.946	Contact Map
3ov9A	3	0.4407	49	0.949	Contact Map
4nqfA	2	0.7458	45.3	0.95	Contact Map
1ufbA	3	0.6836	39.3	0.951	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.