Q97YA7 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97YA7 - Uncharacterized protein

UniProt:	Q97YA7	Sequences: MKMSCMDLDVITTVVKIEGKLRNETLLRVGKGKTQDFAEATDNPIIKYRDRPLIPGSSLKGAFRSLVESYTKSLNDSKYYVCDLDDNSCVSCEEKKKDNGIVEGRYCIPCILFGFKDLASRVYILDAIAEKYSISQRTMVAINRVFGGQMPGHLYTLDYVDPGSEFSFMMMIYNLNLIEGEKDWKAKSVEALKFLLATLVREGIFVGARKSVGYGLIKLVDAKVSLYKAPDHLVSPVIVKKLEEVIGTNG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	250 (195)
Sequences:	816 (708)
Seq/√Len:	50.7

SULSO - Q97YA7 Q97YA6 Q97YA0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
107_C	110_C	8.969	1.00
63_F	124_I	5.104	1.00
19_G	168_F	4.377	1.00
24_E	218_K	4.322	1.00
138_T	156_T	3.735	1.00
20_K	165_E	3.578	1.00
127_A	168_F	3.573	1.00
48_Y	51_R	3.120	1.00
22_R	165_E	3.030	1.00
21_L	217_I	2.890	1.00
47_K	158_D	2.694	1.00
22_R	220_V	2.647	1.00
140_V	149_Q	2.596	1.00
16_K	169_M	2.578	1.00
59_L	127_A	2.373	1.00
67_V	195_L	2.115	1.00
27_L	206_V	2.070	1.00
143_N	150_M	2.012	1.00
18_E	169_M	1.990	1.00
14_V	173_Y	1.973	1.00
152_G	155_Y	1.930	0.99
57_S	126_D	1.917	0.99
111_I	188_S	1.903	0.99
66_L	198_T	1.694	0.98
209_R	214_Y	1.648	0.98
67_V	191_A	1.621	0.98
130_E	167_S	1.594	0.98
63_F	195_L	1.577	0.98
68_E	107_C	1.567	0.97
22_R	218_K	1.557	0.97
67_V	71_T	1.553	0.97
26_L	214_Y	1.540	0.97
139_M	212_V	1.498	0.97
112_L	172_I	1.477	0.96
205_F	210_K	1.465	0.96
18_E	223_K	1.461	0.96
73_S	197_A	1.423	0.96
141_A	144_R	1.409	0.95
187_K	190_E	1.408	0.95
62_A	204_I	1.365	0.94
23_N	27_L	1.359	0.94
172_I	188_S	1.357	0.94
26_L	159_Y	1.357	0.94
95_K	98_D	1.354	0.94
20_K	221_D	1.312	0.93
205_F	216_L	1.300	0.93
52_P	160_V	1.297	0.93
138_T	154_L	1.293	0.93
125_L	169_M	1.291	0.93
70_Y	194_F	1.283	0.92
119_A	214_Y	1.280	0.92
18_E	167_S	1.269	0.92
172_I	175_L	1.258	0.92
28_R	208_A	1.241	0.91
149_Q	210_K	1.240	0.91
23_N	164_S	1.232	0.91
143_N	148_G	1.210	0.90
122_V	170_M	1.193	0.89
191_A	195_L	1.184	0.89
16_K	171_M	1.170	0.88
63_F	192_L	1.166	0.88
30_G	208_A	1.165	0.88
28_R	158_D	1.159	0.88
26_L	137_R	1.154	0.88
129_A	164_S	1.149	0.87
42_D	46_I	1.129	0.86
139_M	155_Y	1.123	0.86
68_E	110_C	1.122	0.86
229_A	232_H	1.119	0.86
161_D	195_L	1.114	0.86
154_L	208_A	1.098	0.85
97_K	100_G	1.093	0.85
60_K	171_M	1.093	0.85
195_L	198_T	1.087	0.84
66_L	204_I	1.077	0.84
53_L	128_I	1.067	0.83
175_L	188_S	1.063	0.83
137_R	140_V	1.028	0.81
18_E	225_S	1.024	0.80
131_K	167_S	1.023	0.80
119_A	219_L	1.018	0.80
43_N	157_L	1.012	0.80
61_G	207_G	1.007	0.79
29_V	166_F	1.006	0.79
21_L	168_F	0.999	0.79
57_S	60_K	0.989	0.78
45_I	52_P	0.985	0.78
139_M	154_L	0.967	0.76
63_F	199_L	0.965	0.76
137_R	214_Y	0.959	0.76
58_S	62_A	0.955	0.76
101_I	105_R	0.955	0.76
31_K	60_K	0.953	0.75
98_D	101_I	0.951	0.75
45_I	134_I	0.946	0.75
212_V	217_I	0.937	0.74
19_G	170_M	0.933	0.74
51_R	129_A	0.928	0.73
74_L	110_C	0.925	0.73
137_R	159_Y	0.915	0.72
225_S	232_H	0.910	0.72
65_S	68_E	0.909	0.72
61_G	215_G	0.907	0.72
207_G	215_G	0.907	0.72
228_K	231_D	0.898	0.71
47_K	50_D	0.894	0.71
146_F	152_G	0.893	0.71
108_I	187_K	0.893	0.71
17_I	224_V	0.883	0.70
125_L	171_M	0.877	0.69
130_E	165_E	0.876	0.69
143_N	146_F	0.873	0.69
142_I	147_G	0.868	0.68
101_I	104_G	0.864	0.68
21_L	166_F	0.860	0.68
42_D	47_K	0.855	0.67
154_L	157_L	0.852	0.67
16_K	225_S	0.845	0.66
51_R	133_S	0.842	0.66
190_E	218_K	0.841	0.66
139_M	214_Y	0.839	0.66
107_C	111_I	0.838	0.66
140_V	155_Y	0.835	0.65
139_M	159_Y	0.835	0.65
70_Y	191_A	0.835	0.65
145_V	148_G	0.834	0.65
56_G	126_D	0.834	0.65
17_I	193_K	0.833	0.65
33_K	50_D	0.832	0.65
176_N	187_K	0.831	0.65
165_E	220_V	0.829	0.65
186_A	190_E	0.816	0.64
206_V	217_I	0.814	0.63
174_N	190_E	0.814	0.63
15_V	224_V	0.813	0.63
135_S	161_D	0.807	0.63
227_Y	232_H	0.806	0.63
24_E	216_L	0.802	0.62
203_G	227_Y	0.799	0.62
149_Q	154_L	0.788	0.61
54_I	199_L	0.781	0.60
117_D	170_M	0.778	0.60
97_K	102_V	0.773	0.59
26_L	139_M	0.769	0.59
26_L	62_A	0.769	0.59
26_L	208_A	0.764	0.58
147_G	152_G	0.763	0.58
66_L	154_L	0.762	0.58
58_S	135_S	0.760	0.58
146_F	155_Y	0.760	0.58
159_Y	214_Y	0.753	0.57
30_G	158_D	0.753	0.57
156_T	209_R	0.752	0.57
102_V	110_C	0.751	0.57
118_L	121_R	0.748	0.57
135_S	139_M	0.747	0.57
41_T	136_Q	0.742	0.56
74_L	100_G	0.740	0.56
142_I	155_Y	0.737	0.56
74_L	77_S	0.732	0.55
106_Y	190_E	0.731	0.55
27_L	162_P	0.723	0.54
56_G	59_L	0.721	0.54
174_N	188_S	0.712	0.53
124_I	172_I	0.711	0.53
51_R	130_E	0.700	0.52
15_V	175_L	0.697	0.52
64_R	68_E	0.697	0.52
175_L	210_K	0.694	0.51
131_K	220_V	0.693	0.51
28_R	170_M	0.692	0.51
77_S	220_V	0.691	0.51
23_N	162_P	0.691	0.51
159_Y	212_V	0.690	0.51
148_G	152_G	0.685	0.50
188_S	196_L	0.683	0.50
166_F	174_N	0.679	0.50
18_E	230_P	0.671	0.49
161_D	208_A	0.670	0.49
71_T	191_A	0.668	0.49
176_N	186_A	0.663	0.48
197_A	211_S	0.662	0.48
20_K	167_S	0.662	0.48
190_E	193_K	0.662	0.48
47_K	164_S	0.660	0.48
59_L	168_F	0.659	0.48
17_I	222_A	0.654	0.47
68_E	71_T	0.652	0.47
112_L	188_S	0.652	0.47
70_Y	193_K	0.645	0.46
38_A	42_D	0.645	0.46
26_L	212_V	0.643	0.46
122_V	196_L	0.642	0.46
42_D	57_S	0.641	0.46
49_R	131_K	0.637	0.45
124_I	170_M	0.636	0.45
62_A	206_V	0.635	0.45
160_V	216_L	0.633	0.45
207_G	213_G	0.633	0.45
61_G	213_G	0.633	0.45
99_N	105_R	0.632	0.45
114_G	207_G	0.628	0.44
61_G	114_G	0.628	0.44
54_I	206_V	0.628	0.44
135_S	162_P	0.624	0.44
227_Y	231_D	0.623	0.44
109_P	226_L	0.622	0.44
64_R	113_F	0.621	0.44
225_S	228_K	0.621	0.44
223_K	226_L	0.619	0.44
17_I	186_A	0.617	0.43
60_K	159_Y	0.617	0.43
39_E	45_I	0.615	0.43
41_T	44_P	0.615	0.43
22_R	130_E	0.614	0.43
228_K	232_H	0.612	0.43
13_T	175_L	0.609	0.43
137_R	212_V	0.607	0.42
157_L	214_Y	0.605	0.42
20_K	222_A	0.604	0.42
56_G	219_L	0.602	0.42
43_N	50_D	0.602	0.42
15_V	189_V	0.601	0.42
196_L	205_F	0.600	0.42
41_T	47_K	0.598	0.41
55_P	126_D	0.589	0.41
77_S	167_S	0.588	0.40
123_Y	163_G	0.587	0.40
45_I	158_D	0.585	0.40
141_A	150_M	0.585	0.40
67_V	166_F	0.584	0.40
186_A	189_V	0.580	0.40
148_G	186_A	0.580	0.40
97_K	101_I	0.580	0.40
23_N	217_I	0.577	0.39
163_G	166_F	0.573	0.39
79_Y	110_C	0.570	0.39
13_T	174_N	0.570	0.39
67_V	112_L	0.568	0.38
74_L	148_G	0.567	0.38
96_K	99_N	0.565	0.38
224_V	229_A	0.564	0.38
18_E	186_A	0.561	0.38
51_R	220_V	0.560	0.38
58_S	65_S	0.560	0.38
21_L	127_A	0.559	0.38
28_R	124_I	0.559	0.38
57_S	127_A	0.559	0.38
73_S	210_K	0.558	0.38
144_R	211_S	0.558	0.38
75_N	186_A	0.558	0.38
65_S	123_Y	0.555	0.37
53_L	164_S	0.554	0.37
35_Q	44_P	0.552	0.37
65_S	191_A	0.552	0.37
52_P	129_A	0.551	0.37
66_L	195_L	0.550	0.37
142_I	158_D	0.546	0.36
47_K	208_A	0.545	0.36
57_S	113_F	0.543	0.36
175_L	211_S	0.543	0.36
157_L	161_D	0.543	0.36
71_T	109_P	0.542	0.36
17_I	187_K	0.541	0.36
70_Y	189_V	0.541	0.36
139_M	157_L	0.539	0.36
73_S	192_L	0.539	0.36
140_V	154_L	0.537	0.35
103_E	106_Y	0.536	0.35
149_Q	152_G	0.533	0.35
123_Y	173_Y	0.530	0.35
67_V	188_S	0.527	0.35
75_N	79_Y	0.526	0.34
74_L	107_C	0.525	0.34
137_R	155_Y	0.525	0.34
120_S	147_G	0.524	0.34
25_T	112_L	0.522	0.34
114_G	215_G	0.520	0.34
147_G	155_Y	0.520	0.34
112_L	217_I	0.518	0.34
196_L	219_L	0.515	0.33
30_G	161_D	0.510	0.33
134_I	158_D	0.508	0.33
102_V	105_R	0.507	0.33
119_A	191_A	0.506	0.33
151_P	155_Y	0.506	0.33
137_R	157_L	0.505	0.33
133_S	170_M	0.503	0.32
69_S	192_L	0.502	0.32
15_V	172_I	0.502	0.32
150_M	160_V	0.500	0.32
25_T	111_I	0.500	0.32

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4qtsC	1	0.676	100	0.37	Contact Map
4n0lA	1	0.864	100	0.391	Contact Map
3x1lC	3	0.828	100	0.451	Contact Map
4w8wA	1	0.592	100	0.458	Contact Map
3x1lH	1	0.776	100	0.5	Contact Map
4w8vA	1	0.772	100	0.5	Contact Map
4txdA	1	0.92	99.4	0.742	Contact Map
4w8zA	1	0.72	98.9	0.791	Contact Map
4l6uA	1	0.736	98.8	0.796	Contact Map
4qtsA	1	0.752	98.3	0.828	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0077 seconds.