Q97Y86 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97Y86 - Uncharacterized protein

UniProt:	Q97Y86	Sequences: MVSVTDLKDYSLCKVIPWIRKKMGWKEPITNSQRIAKNVNLKEIVRDFPEPKYYEVHLRDKDSGLNGIVDVLTEDSVIEIKAFYRRFYNHFRIQLLAYAYLAERNGFRVRNTVLLMNKERKINIEVRKEHVEYIGKVVNELVESLEDDSPPVVNPSPLLCKACQYRRVCSVSVLL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	175 (165)
Sequences:	899 (715)
Seq/√Len:	55.6

SULSO - Q97Y86 Q97YD3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
111_N	123_N	4.349	1.00
58_L	69_V	4.019	1.00
62_D	135_G	3.338	1.00
103_E	131_V	3.330	1.00
60_D	104_R	3.121	1.00
10_Y	14_K	3.035	1.00
89_N	133_Y	2.920	1.00
96_L	126_V	2.887	1.00
17_P	141_L	2.597	1.00
14_K	140_E	2.467	1.00
156_S	159_L	2.364	1.00
91_F	116_M	2.213	1.00
36_A	44_I	2.211	1.00
76_S	113_V	2.188	1.00
64_G	142_V	2.185	1.00
92_R	122_I	2.128	1.00
36_A	43_E	2.070	1.00
36_A	42_K	2.050	1.00
100_Y	134_I	2.034	1.00
77_V	112_T	1.953	1.00
8_K	16_I	1.915	1.00
36_A	40_N	1.878	1.00
36_A	39_V	1.876	1.00
85_R	119_E	1.760	0.99
89_N	92_R	1.726	0.99
112_T	126_V	1.679	0.99
132_E	136_K	1.678	0.99
31_N	82_A	1.630	0.99
65_L	138_V	1.592	0.98
10_Y	144_S	1.571	0.98
52_K	71_V	1.560	0.98
4_V	101_L	1.558	0.98
16_I	20_R	1.548	0.98
136_K	140_E	1.499	0.98
35_I	39_V	1.491	0.97
12_L	31_N	1.488	0.97
18_W	22_K	1.467	0.97
55_E	68_I	1.456	0.97
96_L	130_H	1.437	0.97
11_S	93_I	1.424	0.97
10_Y	140_E	1.420	0.97
99_A	126_V	1.419	0.97
53_Y	74_E	1.408	0.96
8_K	91_F	1.396	0.96
27_E	168_V	1.381	0.96
96_L	134_I	1.380	0.96
25_W	168_V	1.372	0.96
10_Y	141_L	1.368	0.96
39_V	42_K	1.368	0.96
9_D	16_I	1.326	0.95
97_A	134_I	1.291	0.94
134_I	138_V	1.277	0.94
56_V	74_E	1.272	0.94
57_H	68_I	1.271	0.94
53_Y	56_V	1.238	0.93
65_L	97_A	1.203	0.92
26_K	32_S	1.199	0.92
36_A	41_L	1.195	0.91
35_I	38_N	1.179	0.91
3_S	24_G	1.179	0.91
76_S	123_N	1.168	0.90
76_S	111_N	1.138	0.89
56_V	72_L	1.133	0.89
18_W	21_K	1.128	0.89
101_L	105_N	1.110	0.88
7_L	93_I	1.084	0.87
160_C	163_C	1.084	0.87
28_P	37_K	1.083	0.87
160_C	169_C	1.083	0.87
6_D	17_P	1.081	0.87
40_N	44_I	1.076	0.86
138_V	142_V	1.065	0.86
82_A	118_K	1.059	0.85
36_A	46_R	1.046	0.85
12_L	159_L	1.041	0.85
95_L	112_T	1.040	0.84
35_I	42_K	1.033	0.84
163_C	169_C	1.015	0.83
3_S	21_K	1.013	0.83
35_I	43_E	1.012	0.83
40_N	43_E	1.009	0.83
36_A	47_D	1.002	0.82
128_K	132_E	0.998	0.82
28_P	32_S	0.991	0.81
27_E	167_R	0.984	0.81
139_N	143_E	0.983	0.81
11_S	133_Y	0.972	0.80
9_D	20_R	0.971	0.80
62_D	143_E	0.962	0.79
95_L	114_L	0.950	0.79
92_R	133_Y	0.940	0.78
85_R	91_F	0.935	0.78
62_D	104_R	0.924	0.77
17_P	91_F	0.921	0.76
31_N	162_A	0.915	0.76
113_V	123_N	0.914	0.76
43_E	71_V	0.910	0.76
72_L	109_V	0.907	0.75
6_D	141_L	0.905	0.75
6_D	21_K	0.904	0.75
112_T	124_I	0.900	0.75
7_L	17_P	0.894	0.74
140_E	143_E	0.894	0.74
125_E	128_K	0.890	0.74
71_V	115_L	0.887	0.74
137_V	140_E	0.884	0.73
96_L	114_L	0.881	0.73
30_T	33_Q	0.881	0.73
143_E	146_E	0.881	0.73
7_L	97_A	0.881	0.73
61_K	138_V	0.870	0.72
111_N	125_E	0.864	0.72
38_N	41_L	0.852	0.71
17_P	144_S	0.841	0.70
63_S	100_Y	0.825	0.68
54_Y	80_I	0.819	0.68
35_I	82_A	0.810	0.67
44_I	55_E	0.809	0.67
99_A	109_V	0.805	0.66
61_K	64_G	0.804	0.66
38_N	44_I	0.798	0.66
81_K	94_Q	0.791	0.65
93_I	133_Y	0.789	0.65
119_E	122_I	0.789	0.65
87_F	92_R	0.787	0.65
41_L	44_I	0.780	0.64
16_I	164_Q	0.777	0.64
102_A	109_V	0.773	0.63
39_V	71_V	0.766	0.62
9_D	18_W	0.765	0.62
10_Y	145_L	0.763	0.62
155_P	166_R	0.754	0.61
8_K	20_R	0.750	0.61
135_G	139_N	0.749	0.61
10_Y	149_S	0.738	0.60
132_E	135_G	0.729	0.59
136_K	139_N	0.728	0.58
40_N	94_Q	0.726	0.58
135_G	138_V	0.725	0.58
136_K	143_E	0.716	0.57
132_E	146_E	0.714	0.57
86_R	91_F	0.714	0.57
12_L	162_A	0.706	0.56
158_L	162_A	0.705	0.56
4_V	67_G	0.700	0.55
77_V	99_A	0.698	0.55
11_S	90_H	0.696	0.55
21_K	24_G	0.694	0.55
102_A	112_T	0.693	0.55
9_D	164_Q	0.692	0.55
79_E	94_Q	0.690	0.54
35_I	47_D	0.686	0.54
132_E	139_N	0.686	0.54
74_E	106_G	0.682	0.54
133_Y	137_V	0.678	0.53
16_I	101_L	0.665	0.52
8_K	88_Y	0.665	0.52
18_W	150_P	0.665	0.52
60_D	64_G	0.664	0.52
22_K	145_L	0.660	0.51
141_L	145_L	0.660	0.51
38_N	42_K	0.660	0.51
58_L	101_L	0.659	0.51
69_V	72_L	0.656	0.51
35_I	44_I	0.655	0.51
18_W	151_P	0.648	0.50
56_V	106_G	0.647	0.50
63_S	135_G	0.645	0.50
143_E	147_D	0.641	0.49
67_G	103_E	0.638	0.49
4_V	134_I	0.628	0.48
3_S	6_D	0.616	0.46
96_L	131_V	0.616	0.46
84_Y	118_K	0.615	0.46
100_Y	138_V	0.614	0.46
154_N	159_L	0.610	0.46
5_T	109_V	0.610	0.46
43_E	46_R	0.609	0.46
35_I	53_Y	0.609	0.46
134_I	141_L	0.607	0.45
4_V	97_A	0.606	0.45
32_S	164_Q	0.606	0.45
85_R	92_R	0.605	0.45
137_V	143_E	0.602	0.45
99_A	112_T	0.596	0.44
83_F	91_F	0.595	0.44
45_V	54_Y	0.595	0.44
100_Y	131_V	0.591	0.44
24_G	68_I	0.591	0.44
110_R	135_G	0.585	0.43
19_I	26_K	0.578	0.42
117_N	120_R	0.576	0.42
11_S	137_V	0.576	0.42
86_R	116_M	0.572	0.42
52_K	60_D	0.569	0.41
23_M	150_P	0.569	0.41
108_R	146_E	0.563	0.41
149_S	153_V	0.561	0.41
161_K	166_R	0.561	0.41
114_L	146_E	0.560	0.40
65_L	90_H	0.560	0.40
70_D	94_Q	0.557	0.40
153_V	156_S	0.554	0.40
79_E	101_L	0.554	0.40
4_V	31_N	0.552	0.40
120_R	124_I	0.551	0.40
42_K	55_E	0.550	0.39
88_Y	133_Y	0.549	0.39
90_H	116_M	0.548	0.39
67_G	101_L	0.547	0.39
128_K	146_E	0.546	0.39
111_N	136_K	0.544	0.39
83_F	165_Y	0.539	0.38
158_L	161_K	0.536	0.38
97_A	138_V	0.534	0.38
73_T	83_F	0.534	0.38
62_D	128_K	0.534	0.38
6_D	9_D	0.533	0.38
110_R	146_E	0.533	0.38
145_L	148_D	0.530	0.37
139_N	152_V	0.529	0.37
85_R	88_Y	0.529	0.37
155_P	159_L	0.528	0.37
100_Y	161_K	0.522	0.37
107_F	132_E	0.522	0.37
86_R	90_H	0.521	0.37
5_T	16_I	0.520	0.36
113_V	121_K	0.520	0.36
106_G	111_N	0.519	0.36
8_K	116_M	0.517	0.36
109_V	131_V	0.517	0.36
79_E	98_Y	0.517	0.36
136_K	146_E	0.516	0.36
111_N	126_V	0.516	0.36
8_K	164_Q	0.515	0.36
141_L	144_S	0.512	0.36
43_E	68_I	0.510	0.35
103_E	109_V	0.508	0.35
6_D	23_M	0.507	0.35
18_W	23_M	0.507	0.35
93_I	134_I	0.506	0.35
16_I	21_K	0.505	0.35
13_C	169_C	0.505	0.35
89_N	127_R	0.504	0.35
32_S	83_F	0.502	0.35
147_D	156_S	0.501	0.35
43_E	47_D	0.500	0.34
40_N	68_I	0.500	0.34

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4r5qA	1	0.8743	99.9	0.552	Contact Map
4ic1A	5	0.9371	99.9	0.568	Contact Map
3u4qB	1	0.9657	99.7	0.674	Contact Map
3l0aA	3	0.9486	99.5	0.726	Contact Map
3h4rA	3	0.8629	99.2	0.758	Contact Map
1w36C	1	0.9543	97.3	0.86	Contact Map
3u4qA	1	0.5771	97.1	0.865	Contact Map
1w36B	1	0.8343	40.3	0.937	Contact Map
3sm4A	3	0.8971	26.5	0.942	Contact Map
3syyA	3	0.8686	16.9	0.948	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.