Q97Y82 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97Y82 - Uncharacterized protein

UniProt:	Q97Y82	Sequences: MRLEIAEKYMAEAYEYLKKGDTIQASGKAYKVAEEIVKAIKFLISKLIGQDVGVISPYRTQVRKLDQELANYKPYVEVNTVDAFQGREKDVIIFSVTATNGLRFVTNRRRLNVAFTRPRYKLIVLGNENSIMSCQMTIC	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	139 (117)
Sequences:	3954 (2680)
Seq/√Len:	247.8

ECOLI - YJHR HELD
HALSA - Q9HNB7 Q9HPR8
SULSO - Q97Y82

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
90_D	120_Y	3.116	1.00
82_D	110_R	3.026	1.00
90_D	119_R	2.949	1.00
36_I	93_I	2.933	1.00
56_S	62_V	2.903	1.00
53_G	89_K	2.858	1.00
51_D	90_D	2.742	1.00
77_E	87_R	2.715	1.00
36_I	125_L	2.623	1.00
53_G	92_I	2.610	1.00
33_A	68_E	2.459	1.00
34_E	68_E	2.278	1.00
96_V	124_V	2.157	1.00
33_A	64_K	2.150	1.00
40_I	54_V	2.073	1.00
32_V	95_S	1.998	1.00
28_K	64_K	1.995	1.00
99_T	127_N	1.993	1.00
94_F	114_A	1.873	1.00
77_E	89_K	1.862	1.00
39_A	125_L	1.655	1.00
91_V	121_K	1.608	1.00
79_N	83_A	1.561	1.00
98_A	103_R	1.440	1.00
48_I	51_D	1.437	1.00
89_K	92_I	1.436	1.00
57_P	81_V	1.417	1.00
96_V	131_I	1.411	1.00
40_I	69_L	1.360	1.00
53_G	84_F	1.356	1.00
100_N	130_S	1.349	1.00
56_S	97_T	1.288	1.00
37_V	68_E	1.260	1.00
62_V	66_D	1.259	1.00
35_E	125_L	1.258	1.00
64_K	68_E	1.251	1.00
69_L	78_V	1.241	1.00
39_A	123_I	1.231	1.00
39_A	93_I	1.225	1.00
88_E	104_F	1.225	1.00
58_Y	104_F	1.178	1.00
36_I	54_V	1.169	1.00
99_T	130_S	1.130	1.00
33_A	37_V	1.108	1.00
41_K	72_Y	1.092	1.00
36_I	95_S	1.081	1.00
64_K	67_Q	1.043	1.00
46_K	50_Q	1.030	1.00
30_Y	64_K	1.027	1.00
62_V	78_V	1.002	1.00
36_I	40_I	1.001	1.00
91_V	123_I	1.000	1.00
55_I	89_K	0.997	1.00
30_Y	68_E	0.996	1.00
65_L	78_V	0.971	1.00
84_F	89_K	0.951	1.00
37_V	41_K	0.943	1.00
33_A	65_L	0.943	1.00
41_K	45_S	0.941	1.00
44_I	49_G	0.934	1.00
126_G	131_I	0.932	1.00
102_L	105_V	0.922	1.00
110_R	113_V	0.904	1.00
115_F	122_L	0.903	1.00
81_V	114_A	0.902	1.00
43_L	91_V	0.900	1.00
57_P	94_F	0.900	1.00
128_E	132_M	0.897	1.00
44_I	52_V	0.890	1.00
93_I	125_L	0.862	0.99
27_G	101_G	0.861	0.99
60_T	63_R	0.858	0.99
116_T	121_K	0.857	0.99
127_N	130_S	0.857	0.99
50_Q	90_D	0.850	0.99
31_K	34_E	0.849	0.99
56_S	65_L	0.839	0.99
107_N	111_L	0.832	0.99
58_Y	98_A	0.827	0.99
27_G	98_A	0.825	0.99
62_V	83_A	0.823	0.99
72_Y	75_Y	0.821	0.99
40_I	44_I	0.818	0.99
30_Y	34_E	0.817	0.99
83_A	88_E	0.817	0.99
85_Q	113_V	0.809	0.99
18_K	22_T	0.808	0.99
26_S	88_E	0.808	0.99
47_L	50_Q	0.805	0.99
98_A	110_R	0.800	0.99
26_S	104_F	0.795	0.99
94_F	124_V	0.786	0.99
47_L	51_D	0.782	0.99
88_E	103_R	0.781	0.99
40_I	52_V	0.770	0.99
26_S	60_T	0.766	0.99
94_F	122_L	0.764	0.99
55_I	83_A	0.764	0.99
31_K	35_E	0.756	0.99
49_G	75_Y	0.752	0.98
85_Q	114_A	0.738	0.98
35_E	38_K	0.732	0.98
38_K	41_K	0.726	0.98
35_E	39_A	0.723	0.98
79_N	84_F	0.718	0.98
57_P	105_V	0.717	0.98
27_G	97_T	0.714	0.98
21_D	28_K	0.699	0.98
57_P	111_L	0.697	0.98
51_D	89_K	0.695	0.97
19_K	30_Y	0.694	0.97
59_R	83_A	0.689	0.97
58_Y	82_D	0.676	0.97
55_I	92_I	0.670	0.97
71_N	74_P	0.664	0.97
79_N	121_K	0.663	0.97
118_P	122_L	0.659	0.97
105_V	131_I	0.658	0.97
24_Q	60_T	0.649	0.96
70_A	75_Y	0.648	0.96
56_S	95_S	0.645	0.96
57_P	114_A	0.644	0.96
104_F	112_N	0.643	0.96
59_R	62_V	0.638	0.96
35_E	42_F	0.632	0.96
39_A	121_K	0.631	0.96
34_E	37_V	0.620	0.95
41_K	71_N	0.611	0.95
18_K	21_D	0.611	0.95
34_E	38_K	0.609	0.95
59_R	66_D	0.606	0.95
19_K	22_T	0.606	0.95
54_V	76_V	0.605	0.94
21_D	25_A	0.601	0.94
129_N	132_M	0.598	0.94
104_F	110_R	0.595	0.94
38_K	42_F	0.595	0.94
65_L	95_S	0.592	0.94
20_G	24_Q	0.586	0.94
59_R	80_T	0.585	0.93
57_P	112_N	0.582	0.93
20_G	23_I	0.581	0.93
106_T	116_T	0.580	0.93
100_N	103_R	0.579	0.93
109_R	119_R	0.575	0.93
18_K	23_I	0.571	0.93
30_Y	75_Y	0.568	0.92
19_K	70_A	0.568	0.92
37_V	65_L	0.567	0.92
83_A	104_F	0.561	0.92
39_A	115_F	0.561	0.92
70_A	74_P	0.559	0.92
55_I	114_A	0.558	0.92
36_I	39_A	0.554	0.91
28_K	60_T	0.551	0.91
37_V	69_L	0.547	0.91
95_S	118_P	0.538	0.90
43_L	52_V	0.536	0.90
46_K	49_G	0.536	0.90
20_G	28_K	0.535	0.90
28_K	33_A	0.535	0.90
48_I	67_Q	0.533	0.90
97_T	124_V	0.526	0.89
42_F	47_L	0.525	0.89
28_K	67_Q	0.519	0.89
48_I	72_Y	0.519	0.89
29_A	118_P	0.519	0.89
28_K	63_R	0.518	0.89
49_G	76_V	0.517	0.88
122_L	130_S	0.516	0.88
79_N	87_R	0.515	0.88
84_F	110_R	0.513	0.88
102_L	106_T	0.512	0.88
41_K	74_P	0.512	0.88
116_T	120_Y	0.504	0.87
22_T	71_N	0.500	0.87

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4b3fX	1	0.9496	100	0.336	Contact Map
2xzlA	1	1	100	0.378	Contact Map
2wjyA	1	1	100	0.388	Contact Map
2gk6A	1	0.9784	100	0.4	Contact Map
4pj3A	1	0.9856	99.9	0.422	Contact Map
3vkwA	1	0.8993	99.7	0.612	Contact Map
3dmnA	1	0.9353	99.6	0.636	Contact Map
4n0nA	1	0.7554	99.5	0.653	Contact Map
3e1sA	1	0.9856	99.4	0.677	Contact Map
1w36D	1	0.6978	99	0.725	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.